• Gene id: 8408

Gene Summary

• Gene Symbol: ULK1   Gene   UCSC   Ensembl
• Aliases: ATG1, ATG1A, UNC51, Unc51.1, hATG1
• Gene name: unc-51 like autophagy activating kinase 1
• Alternate names: serine/threonine-protein kinase ULK1, ATG1 autophagy related 1 homolog, autophagy-related protein 1 homolog,
• Gene location: 12q24.33 (131894621: 131923149)     Exons: 5     NC_000012.12
• OMIM: 603168

Protein Summary

• Protein general information: O75385  
  • Name: Serine/threonine protein kinase ULK1 (EC 2.7.11.1) (Autophagy related protein 1 homolog) (ATG1) (hATG1) (Unc 51 like kinase 1)
  • Length: 1050  
  • Mass: 112631
  • Tissue specificity: Ubiquitously expressed. Detected in the following adult tissues
• Sequence:

  MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKELKHENI
  VALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLKPQNILLSNPA
  GRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASS
  PQDLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDASPSVRKSPPVPVPSYPSSGS
  GSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDSSCDTDDFVMVPAQFPGDLVAEAPSA
  KPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS
  PTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVLARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQG
  AEMRGGRSPRPGSSAPEHSPRTSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCR
  NLRGSPKLPDFLQRNPLPPILGSPTKAVPSFDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPL
  GPGLRPGEDPKGPFGRSFSTSRLTDLLLKAAFGTQAPDPGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPS
  PVVFTVGSPPSGSTPPQGPRTRMFSAGPTGSASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTF
  EAPDLPEETLMEQEHTEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQL
  VLYLKVAELLSSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDRIHSIT
  AERLIFSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA

• Structural information:
  • Protein Domains: (16..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR016237  IPR008271   IPR022708  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4WNO 4WNP 5CI7 6HYO 6MNH 6QAS
  • PDBsum: 4WNO 4WNP 5CI7 6HYO 6MNH 6QAS
  • DIP: 35196
  • STRING: ENSP00000324560
• Other Databases: GeneCards:  ULK1  Malacards:  ULK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0048675	axon extension	IBA	biological process
GO:0000045	autophagosome assembly	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0097629	extrinsic component of omegasome membrane	IDA	cellular component
GO:0097635	extrinsic component of autophagosome membrane	IDA	cellular component
GO:0097632	extrinsic component of phagophore assembly site membrane	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0010508	positive regulation of autophagy	IDA	biological process
GO:0034045	phagophore assembly site membrane	IDA	cellular component
GO:0006914	autophagy	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0042594	response to starvation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990316	Atg1/ULK1 kinase complex	IPI	cellular component
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0031669	cellular response to nutrient levels	ISS	biological process
GO:0006914	autophagy	ISS	biological process
GO:0006914	autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010508	positive regulation of autophagy	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0032045	guanyl-nucleotide exchange factor complex	IDA	colocalizes with
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016301	kinase activity	TAS	molecular function
GO:0055037	recycling endosome	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000786	positive regulation of autophagosome assembly	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0031102	neuron projection regeneration	IEA	biological process
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016236	macroautophagy	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008104	protein localization	IMP	biological process
GO:0005737	cytoplasm	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031175	neuron projection development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006468	protein phosphorylation	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051020	GTPase binding	IPI	molecular function
GO:0075044	positive regulation by symbiont of host autophagy	IGI	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa04150	mTOR signaling pathway
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04152	AMPK signaling pathway
hsa04211	Longevity regulating pathway
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq