Search Result
Gene id | 8407 | ||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | TAGLN2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | HA1756 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | transgelin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | transgelin-2, SM22-alpha homolog, epididymis secretory sperm binding protein, epididymis tissue protein Li 7e, | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
1q23.2 (159925506: 159918110) Exons: 7 NC_000001.11 |
||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor |
||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 609689 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | P37802 Name: Transgelin 2 (Epididymis tissue protein Li 7e) (SM22 alpha homolog) Length: 199 Mass: 22391 Tissue specificity: Expressed in epididymis (at protein level). {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALYPEGQA PVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNW FPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL | ||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: TAGLN2 Malacards: TAGLN2 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
|