• Gene id: 8407

Gene Summary

• Gene Symbol: TAGLN2   Gene   UCSC   Ensembl
• Aliases: HA1756
• Gene name: transgelin 2
• Alternate names: transgelin-2, SM22-alpha homolog, epididymis secretory sperm binding protein, epididymis tissue protein Li 7e,
• Gene location: 1q23.2 (159925506: 159918110)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor
• OMIM: 609689

Protein Summary

• Protein general information: P37802  
  • Name: Transgelin 2 (Epididymis tissue protein Li 7e) (SM22 alpha homolog)
  • Length: 199  
  • Mass: 22391
  • Tissue specificity: Expressed in epididymis (at protein level). {ECO
• Sequence:

  MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALYPEGQA
  PVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGLFSGDPNW
  FPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL

• Structural information:
  • Protein Domains: (24..13-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044"-)
  • Interpro: IPR000557  IPR001715  IPR036872  IPR003096  IPR001061  
  • Prosite: PS01052 PS51122 PS50021
  • CDD: cd00014
  • PDB: 1WYM
  • PDBsum: 1WYM
  • STRING: ENSP00000357076
• Other Databases: GeneCards:  TAGLN2  Malacards:  TAGLN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002576	platelet degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0030855	epithelial cell differentiation	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881