• Gene id: 84068

Gene Summary

• Gene Symbol: SLC10A7   Gene   UCSC   Ensembl
• Aliases: C4orf13, P7, SSASKS
• Gene name: solute carrier family 10 member 7
• Alternate names: sodium/bile acid cotransporter 7, Na(+)/bile acid cotransporter 7, SBF-domain containing protein, solute carrier family 10 (sodium/bile acid cotransporter family), member 7,
• Gene location: 4q31.22 (146522350: 146253980)     Exons: 18     NC_000004.12

Protein Summary

• Protein general information: Q0GE19  
  • Name: Sodium/bile acid cotransporter 7 (Na(+)/bile acid cotransporter 7) (Solute carrier family 10 member 7)
  • Length: 340  
  • Mass: 37432
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MRLLERMRKDWFMVGIVLAIAGAKLEPSIGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHLKLHLF
  IQIFTLAFFPATIWLFLQLLSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLGIVIT
  PLLLLLFLGSSSSVPFTSIFSQLFMTVVVPLIIGQIVRRYIKDWLERKKPPFGAISSSVLLMIIYTTFCDTFSNP
  NIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTPADTVAIIFCSTHKSLTLGIPMLKIVFAGHEHLSLI
  SVPLLIYHPAQILLGSVLVPTIKSWMVSRQKGVKLTRPTV

• Structural information:
  • Interpro: IPR038770  IPR016833  
  • STRING: ENSP00000421275
• Other Databases: GeneCards:  SLC10A7  Malacards:  SLC10A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006874	cellular calcium ion homeostasis	IMP	biological process
GO:0060348	bone development	IMP	biological process
GO:0030210	heparin biosynthetic process	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0031226	intrinsic component of plasma membrane	IEA	cellular component
GO:0060348	bone development	IEA	biological process
GO:0030210	heparin biosynthetic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015721	bile acid and bile salt transport	IEA	biological process
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0015125	bile acid transmembrane transporter activity	IDA	molecular function
GO:0034436	glycoprotein transport	IDA	biological process
GO:0005797	Golgi medial cisterna	IDA	cellular component
GO:0048193	Golgi vesicle transport	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq