• Gene id: 84061

Gene Summary

• Gene Symbol: MAGT1   Gene   UCSC   Ensembl
• Aliases: CDG1CC, IAP, MRX95, OST3B, PRO0756, SLC58A1, XMEN, bA217H1.1
• Gene name: magnesium transporter 1
• Alternate names: magnesium transporter protein 1, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1, implantation-associated protein, oligosaccharyl transferase subunit MAGT1, oligosaccharyltransferase 3 homolog B,
• Gene location: Xq21.1 (77895567: 77825746)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a ubiquitously expressed magnesium cation transporter protein that localizes to the cell membrane. This protein also associates with N-oligosaccharyl transferase and therefore may have a role in N-glycosylation. Mutations in this gene ca
• OMIM: 300715

Protein Summary

• Protein general information: Q9H0U3  
  • Name: Magnesium transporter protein 1 (MagT1) (Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit MAGT1) (Oligosaccharyl transferase subunit MAGT1) (Implantation associated protein) (IAP)
  • Length: 335  
  • Mass: 38037
  • Tissue specificity: Ubiquitous. Expressed at very low levels in brain, lung and kidney. {ECO
• Sequence:

  MAARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVI
  VMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPKR
  GDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALC
  FVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRK
  IMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS

• Structural information:
  • Protein Domains: (47..17-)
    (/note="Thioredoxin"-)
  • Interpro: IPR006844  IPR021149  IPR036249  
  • PDB: 6S7T
  • PDBsum: 6S7T
  • STRING: ENSP00000354649
• Other Databases: GeneCards:  MAGT1  Malacards:  MAGT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0006487	protein N-linked glycosylation	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0050890	cognition	IMP	biological process
GO:0015095	magnesium ion transmembrane transporter activity	IMP	molecular function
GO:0015693	magnesium ion transport	IMP	biological process
GO:0008250	oligosaccharyltransferase complex	IDA	cellular component
GO:0008250	oligosaccharyltransferase complex	IBA	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008250	oligosaccharyltransferase complex	IEA	cellular component
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0015095	magnesium ion transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015095	magnesium ion transmembrane transporter activity	TAS	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0008250	oligosaccharyltransferase complex	IDA	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IMP	biological process
GO:0006487	protein N-linked glycosylation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881