• Gene id: 84057

Gene Summary

• Gene Symbol: MND1   Gene   UCSC   Ensembl
• Aliases: GAJ
• Gene name: meiotic nuclear divisions 1
• Alternate names: meiotic nuclear division protein 1 homolog, homolog of yeast MND1, meiotic nuclear divisions 1 homolog,
• Gene location: 4q31.3 (153344648: 153415096)     Exons: 11     NC_000004.12
• Gene summary(Entrez): The product of the MND1 gene associates with HOP2 (MIM 608665) to form a stable heterodimeric complex that binds DNA and stimulates the recombinase activity of RAD51 (MIM 179617) and DMC1 (MIM 602721) (Chi et al., 2007 [PubMed 17639080]). Both the MND1 an
• OMIM: 611422

Protein Summary

• Protein general information: Q9BWT6  
  • Name: Meiotic nuclear division protein 1 homolog
  • Length: 205  
  • Mass: 23,753
• Sequence:

  MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFP
  SKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQ
  VVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID

• Structural information:
  • Interpro: IPR005647  IPR036390  
  • STRING: ENSP00000240488
• Other Databases: GeneCards:  MND1  Malacards:  MND1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 23675907
Sertoli cell only syndrome (SCOS)	MIK: 23675907
Maturation arrest	MIK: 23675907
Hypospermatogenesis (HS)	MIK: 23675907
Maturation arrest (MA)	MIK: 23675907
Sertoli cell-only syndrome (SCO)	MIK: 23675907
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23675907	Hypospermatogenesis (HS) maturation arrest (MA), Sertoli cell-only syndrome (SCO)				Male infertility	MND1 SPATA22 GAPDHS and ACR
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray