• Gene id: 8404

Gene Summary

• Gene Symbol: SPARCL1   Gene   UCSC   Ensembl
• Aliases: MAST 9, MAST9, PIG33, SC1
• Gene name: SPARC like 1
• Alternate names: SPARC-like protein 1, SPARC-like 1 (hevin), high endothelial venule protein, proliferation-inducing protein 33,
• Gene location: 4q22.1 (87529502: 87473329)     Exons: 14     NC_000004.12

Protein Summary

• Protein general information: Q14515  
  • Name: SPARC like protein 1 (High endothelial venule protein) (Hevin) (MAST 9)
  • Length: 664  
  • Mass: 75208
  • Tissue specificity: Highly expressed in lymph node, brain, heart, lung, skeletal muscle, ovary, small intestine, and colon, with lower levels in placenta, pancreas, testis, spleen, and thymus, and no expression in kidney, liver, and peripheral blood leuko
• Sequence:

  MKTGLFFLCLLGTAAAIPTNARLLSDHSKPTAETVAPDNTAIPSLRAEAEENEKETAVSTEDDSHHKAEKSSVLK
  SKEESHEQSAEQGKSSSQELGLKDQEDSDGHLSVNLEYAPTEGTLDIKEDMSEPQEKKLSENTDFLAPGVSSFTD
  SNQQESITKREENQEQPRNYSHHQLNRSSKHSQGLRDQGNQEQDPNISNGEEEEEKEPGEVGTHNDNQERKTELP
  REHANSKQEEDNTQSDDILEESDQPTQVSKMQEDEFDQGNQEQEDNSNAEMEEENASNVNKHIQETEWQSQEGKT
  GLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNHGVDDDGDDDGDDGGTDGPRHSASDDYFIPSQAFLEAERAQ
  SIAYHLKIEEQREKVHENENIGTTEPGEHQEAKKAENSSNEEETSSEGNMRVHAVDSCMSFQCKRGHICKADQQG
  KPHCVCQDPVTCPPTKPLDQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVIQFPL
  RMRDWLKNILMQLYEANSEHAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELD
  QHPMDRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF

• Structural information:
  • Protein Domains: (432..45-)
    (/note="Follistatin-like-)
    (450..51-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (622..65-)
    (/note="EF-hand-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR003645  IPR015369   IPR002350  IPR036058  IPR001999  IPR016359  IPR019577  
  • Prosite: PS00018 PS50222 PS51465 PS00612 PS00613
  • STRING: ENSP00000414856
• Other Databases: GeneCards:  SPARCL1  Malacards:  SPARCL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050840	extracellular matrix binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0005509	calcium ion binding	IBA	molecular function
GO:0048856	anatomical structure development	IBA	biological process
GO:0005518	collagen binding	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0005576	extracellular region	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R