• Gene id: 8402

Gene Summary

• Gene Symbol: SLC25A11   Gene   UCSC   Ensembl
• Aliases: OGC, PGL6, SLC20A4
• Gene name: solute carrier family 25 member 11
• Alternate names: mitochondrial 2-oxoglutarate/malate carrier protein, OGCP, solute carrier family 20 (oxoglutarate carrier), member 4, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11,
• Gene location: 17p13.2 (4940250: 4937129)     Exons: 8     NC_000017.11
• Gene summary(Entrez): The oxoglutarate/malate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids (summary by Iacobazzi et al., 1992 [PubMed 1457818]).[supplied by OMIM, Jan 2011]
• OMIM: 604165

Protein Summary

• Protein general information: Q02978  
  • Name: Mitochondrial 2 oxoglutarate/malate carrier protein (OGCP) (Solute carrier family 25 member 11)
  • Length: 314  
  • Mass: 34062
• Sequence:

  MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAE
  GLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTAD
  GRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCA
  SMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
  EQMNKAYKRLFLSG

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000225665
• Other Databases: GeneCards:  SLC25A11  Malacards:  SLC25A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015367	oxoglutarate:malate antiporter activity	IBA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015367	oxoglutarate:malate antiporter activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0071423	malate transmembrane transport	IEA	biological process
GO:0071423	malate transmembrane transport	IEA	biological process
GO:0015742	alpha-ketoglutarate transport	IEA	biological process
GO:0015742	alpha-ketoglutarate transport	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)