• Gene id: 84000

Gene Summary

• Gene Symbol: TMPRSS13   Gene   UCSC   Ensembl
• Aliases: MSP, MSPL, MSPS, TMPRSS11
• Gene name: transmembrane serine protease 13
• Alternate names: transmembrane protease serine 13, membrane-type mosaic serine protease, transmembrane protease, serine 11, transmembrane protease, serine 13,
• Gene location: 11q23.3 (117929452: 117900640)     Exons: 14     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the type II transmembrane serine protease family. Transmembrane serine proteases are regulated by protease inhibitors and known to function in development, homeostasis, infection, and tumorigenesis. Multiple transcript varian
• OMIM: 608928

Protein Summary

• Protein general information: Q9BYE2  
  • Name: Transmembrane protease serine 13 (EC 3.4.21. ) (Membrane type mosaic serine protease) (Mosaic serine protease)
  • Length: 586  
  • Mass: 63167
  • Tissue specificity: Isoform 1 and isoform 3 are predominantly expressed in lung, placenta, pancreas, and prostate. Isoform 3 is weakly expressed in testis and peripheral blood lymphocytes. {ECO
• Sequence:

  MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQASPAGTPPGRASPGRAS
  PAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVYLVRATPVGAVPIRSSPARSAPATRATRESP
  GTSLPKFTWREGQKQLPLIGCVLLLIALVVSLIILFQFWQGHTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELG
  CVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLH
  RSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKV
  LEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMHGQTFSLNETCWI
  TGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYL
  AGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMEVRSLQQDTAPSRLGTSSGGDPGGAPRL

• Structural information:
  • Protein Domains: (195..32-)
    (/note="SRCR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (204..22-)
    A (/note="LDL-receptor-class)
    (326..55-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR036055  IPR002172  IPR009003  IPR001314  IPR017327   IPR001190  IPR017448  IPR036772  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50287 PS50240 PS00134 PS00135
  • CDD: cd00112 cd00190
  • STRING: ENSP00000434279
• Other Databases: GeneCards:  TMPRSS13  Malacards:  TMPRSS13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0072562	blood microparticle	HDA	cellular component
GO:0004252	serine-type endopeptidase activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq