• Gene id: 8399

Gene Summary

• Gene Symbol: PLA2G10   Gene   UCSC   Ensembl
• Aliases: GXPLA2, GXSPLA2, SPLA2, sPLA2-X
• Gene name: phospholipase A2 group X
• Alternate names: group 10 secretory phospholipase A2, group X secretory phospholipase A2, phosphatidylcholine 2-acylhydrolase 10,
• Gene location: 16p13.12 (14694661: 14672547)     Exons: 8     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the phospholipase A2 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This calciu
• OMIM: 603603

Protein Summary

• Protein general information: O15496  
  • Name: Group 10 secretory phospholipase A2 (EC 3.1.1.4) (Group X secretory phospholipase A2) (GX sPLA2) (sPLA2 X) (Phosphatidylcholine 2 acylhydrolase 10)
  • Length: 165  
  • Mass: 18153
  • Tissue specificity: Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon. {ECO
• Sequence:

  MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHG
  QPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYL
  FYPQFLCEPDSPKCD

• Structural information:
  • Interpro: IPR001211  IPR033112  IPR016090  IPR036444  IPR033113  
  • Prosite: PS00119 PS00118
  • CDD: cd00125
  • PDB: 1LE6 1LE7 4UY1 5G3M 5OW8 5OWC 6G5J
  • PDBsum: 1LE6 1LE7 4UY1 5G3M 5OW8 5OWC 6G5J
  • STRING: ENSP00000393847
• Other Databases: GeneCards:  PLA2G10  Malacards:  PLA2G10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043433	negative regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0046473	phosphatidic acid metabolic process	IDA	biological process
GO:0046337	phosphatidylethanolamine metabolic process	IDA	biological process
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0046470	phosphatidylcholine metabolic process	IDA	biological process
GO:0062234	platelet activating factor catabolic process	IDA	biological process
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0006658	phosphatidylserine metabolic process	IDA	biological process
GO:0046471	phosphatidylglycerol metabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0034374	low-density lipoprotein particle remodeling	IDA	biological process
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0047498	calcium-dependent phospholipase A2 activity	IDA	molecular function
GO:0001669	acrosomal vesicle	ISS	cellular component
GO:2000344	positive regulation of acrosome reaction	ISS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0051977	lysophospholipid transport	IDA	biological process
GO:0007411	axon guidance	IDA	biological process
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004620	phospholipase activity	IEA	molecular function
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0090238	positive regulation of arachidonic acid secretion	IEA	biological process
GO:0090370	negative regulation of cholesterol efflux	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0004620	phospholipase activity	ISS	molecular function
GO:0010744	positive regulation of macrophage derived foam cell differentiation	IC	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IMP	biological process
GO:0032308	positive regulation of prostaglandin secretion	IMP	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0090238	positive regulation of arachidonic acid secretion	ISS	biological process
GO:0010884	positive regulation of lipid storage	IMP	biological process
GO:0019369	arachidonic acid metabolic process	NAS	biological process
GO:0043030	regulation of macrophage activation	IMP	biological process
GO:0090370	negative regulation of cholesterol efflux	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa00564	Glycerophospholipid metabolism
hsa04972	Pancreatic secretion
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)