• Gene id: 83983

Gene Summary

• Gene Symbol: TSSK6   Gene   UCSC   Ensembl
• Aliases: CT72, FKSG82, SSTK, TSSK4
• Gene name: testis specific serine kinase 6
• Alternate names: testis-specific serine/threonine-protein kinase 6, TSK-6, cancer/testis antigen 72, serine/threonine protein kinase SSTK, small serine/threonine kinase, testis secretory sperm-binding protein Li 205a,
• Gene location: 19p13.11 (19515659: 19514218)     Exons: 1     NC_000019.10
• Gene summary(Entrez): This intronless gene encodes a member of the CAMK (calcium/calmodulin-dependent) serine/threonine protein kinase family. The encoded kinase has a broad expression pattern but is described as testis-specific due to effects on fertility. Male mice which lac
• OMIM: 610712

Protein Summary

• Protein general information: Q9BXA6  
  • Name: Testis specific serine/threonine protein kinase 6 (TSK 6) (TSSK 6) (Testis specific kinase 6) (EC 2.7.11.1) (Cancer/testis antigen 72) (CT72) (Serine/threonine protein kinase SSTK) (Small serine/threonine kinase)
  • Length: 273  
  • Mass: 30,331
  • Tissue specificity: Detected in skin fibroblasts. {ECO
• Sequence:

  MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHV
  FEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRV
  KLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQK
  RGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG

• Structural information:
  • Protein Domains: Protein (12-267)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000354168
• Other Databases: GeneCards:  TSSK6  Malacards:  TSSK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0035092	sperm chromatin condensation	ISS	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0035092	sperm chromatin condensation	IEA	biological process
GO:0035092	sperm chromatin condensation	ISS	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0035092	sperm chromatin condensation	ISS	biological process
GO:0035556	intracellular signal transduction	IBA	biological process

Diseases

Associated diseases	References
Spermatogenesis defects	GAD: 20037600
Spermatogenesis defects	MIK: 19926886
Cryptorchidism	MIK: 28606200
Male fertility	MIK: 15870294
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 19926886
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20037600	Spermatogenic impairment	c.822+126T>G/C		878 (519 patients with azoospermia (n = 273) or severe oligozoospermia (n = 246), 359 controls)	Male infertility
19926886	Spermatogenic impairment	c.80A>G (rs3747052), c.774C>T (rs1052756), c.839C>T (rs1052763), and c.1026G>A (rs1052773)		851 (494 patients with azoospermia or severe oligozoospermia, 357 fertile controls)	Male infertility
15870294	Essential for male fertility				Male infertility
28389581	Spermiogenesis, male infertility				Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq