• Gene id: 83982

Gene Summary

• Gene Symbol: IFI27L2   Gene   UCSC   Ensembl
• Aliases: FAM14A, ISG12B, TLH29
• Gene name: interferon alpha inducible protein 27 like 2
• Alternate names: interferon alpha-inducible protein 27-like protein 2, ISG12(b) protein, family with sequence similarity 14, member A, interferon-stimulated gene 12b protein, pIFI27-like protein,
• Gene location: 14q32.12 (94129603: 94127780)     Exons: 4     NC_000014.9
• OMIM: 606266

Protein Summary

• Protein general information: Q9H2X8  
  • Name: Interferon alpha inducible protein 27 like protein 2 (Interferon stimulated gene 12b protein) (ISG12(b)) (ISG12B) (Protein TLH29) (pIFI27 like protein)
  • Length: 130  
  • Mass: 12410
• Sequence:

  MMKRAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAGLSTSS
  NILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE

• Structural information:
  • Interpro: IPR009311  IPR038213  
  • STRING: ENSP00000238609
• Other Databases: GeneCards:  IFI27L2  Malacards:  IFI27L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0006915	apoptotic process	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0006915	apoptotic process	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R