• Gene id: 8396

Gene Summary

• Gene Symbol: PIP4K2B   Gene   UCSC   Ensembl
• Aliases: PI5P4KB, PIP5K2B, PIP5KIIB, PIP5KIIbeta, PIP5P4KB
• Gene name: phosphatidylinositol-5-phosphate 4-kinase type 2 beta
• Alternate names: phosphatidylinositol 5-phosphate 4-kinase type-2 beta, 1-phosphatidylinositol 5-phosphate 4-kinase 2-beta, 1-phosphatidylinositol-4-phosphate kinase, PI(5)P 4-kinase type II beta, PIP4KII-beta, PTDINS(4)P-5-kinase, diphosphoinositide kinase 2-beta, phosphatidyli,
• Gene location: 17q12 (38799904: 38765690)     Exons: 13     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. This gene is a member of the phosphatidylinositol-5-phosphate

Protein Summary

• Protein general information: P78356  
  • Name: Phosphatidylinositol 5 phosphate 4 kinase type 2 beta (EC 2.7.1.149) (1 phosphatidylinositol 5 phosphate 4 kinase 2 beta) (Diphosphoinositide kinase 2 beta) (Phosphatidylinositol 5 phosphate 4 kinase type II beta) (PI(5)P 4 kinase type II beta) (PIP4KII b
  • Length: 416  
  • Mass: 47378
  • Tissue specificity: Highly expressed in brain, heart, pancreas, skeletal muscle and kidney. Detected at lower levels in placenta, lung and liver. {ECO
• Sequence:

  MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDDFKAYS
  KIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIK
  TVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLTVHRKYDLKGSTVARE
  ASDKEKAKDLPTFKDNDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYSLLVGIHDVDRAEQEEMEVEE
  RAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYAMKSHESSPKKEVYFMAIIDILTPYD
  TKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT

• Structural information:
  • Protein Domains: (38..41-)
    (/note="PIPK-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00781"-)
  • Interpro: IPR023610  IPR027483  IPR002498  IPR027484  
  • Prosite: PS51455
  • PDB: 1BO1 3WZZ 3X01 3X02 3X03 3X04 3X05 3X06 3X07 3X08 3X09 3X0A 3X0B 3X0C
  • PDBsum: 1BO1 3WZZ 3X01 3X02 3X03 3X04 3X05 3X06 3X07 3X08 3X09 3X0A 3X0B 3X0C
  • STRING: ENSP00000482548
• Other Databases: GeneCards:  PIP4K2B  Malacards:  PIP4K2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000786	positive regulation of autophagosome assembly	IMP	biological process
GO:0010506	regulation of autophagy	IMP	biological process
GO:0005776	autophagosome	IMP	cellular component
GO:0046488	phosphatidylinositol metabolic process	IEA	biological process
GO:0016307	phosphatidylinositol phosphate kinase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0016309	1-phosphatidylinositol-5-phosphate 4-kinase activity	IEA	molecular function
GO:0016308	1-phosphatidylinositol-4-phosphate 5-kinase activity	IDA	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046488	phosphatidylinositol metabolic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04810	Regulation of actin cytoskeleton
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881