• Gene id: 83940

Gene Summary

• Gene Symbol: TATDN1   Gene   UCSC   Ensembl
• Aliases: CDA11
• Gene name: TatD DNase domain containing 1
• Alternate names: putative deoxyribonuclease TATDN1, hepatocarcinoma high expression protein,
• Gene location: 8q24.13 (124540485: 124488493)     Exons: 15     NC_000008.11

Protein Summary

• Protein general information: Q6P1N9  
  • Name: Putative deoxyribonuclease TATDN1 (EC 3.1.21. ) (Hepatocarcinoma high expression protein)
  • Length: 297  
  • Mass: 33602
• Sequence:

  MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMFFSTVG
  CHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTKLPMFLHC
  RNSHAEFLDIMKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLKSIPSEKLMIETDAPW
  CGVKSTHAGSKYIRTAFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLELANTLYNNTIKVFFPGI

• Structural information:
  • Interpro: IPR018228  IPR032466  IPR001130  
  • Prosite: PS01091
  • CDD: cd01310
  • PDB: 2XIO
  • PDBsum: 2XIO
  • STRING: ENSP00000276692
• Other Databases: GeneCards:  TATDN1  Malacards:  TATDN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008296	3'-5'-exodeoxyribonuclease activity	IBA	molecular function
GO:0016788	hydrolase activity, acting on ester bonds	IEA	molecular function
GO:0016888	endodeoxyribonuclease activity, producing 5'-phosphomonoesters	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0006259	DNA metabolic process	IEA	biological process
GO:0006259	DNA metabolic process	IEA	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq