About Us

Search Result


Gene id 83939
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol EIF2A   Gene   UCSC   Ensembl
Aliases CDA02, EIF-2A, MST089, MSTP004, MSTP089
Gene name eukaryotic translation initiation factor 2A
Alternate names eukaryotic translation initiation factor 2A, 65 kDa eukaryotic translation initiation factor 2A, eukaryotic translation initiation factor 2A, 65kDa,
Gene location 3q25.1 (150546677: 150586015)     Exons: 14     NC_000003.12
Gene summary(Entrez) This gene encodes a eukaryotic translation initiation factor that catalyzes the formation of puromycin-sensitive 80 S preinitiation complexes and the poly(U)-directed synthesis of polyphenylalanine at low concentrations of Mg2+. This gene should not be co
OMIM 609234

Protein Summary

Protein general information Q9BY44  

Name: Eukaryotic translation initiation factor 2A (eIF 2A) (65 kDa eukaryotic translation initiation factor 2A) [Cleaved into: Eukaryotic translation initiation factor 2A, N terminally processed]

Length: 585  Mass: 64990

Tissue specificity: Widely expressed. Expressed at higher level in pancreas, heart, brain and placenta. {ECO

Sequence MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVNIISVTNKGLLHSFDL
LKAVCLEFSPKNTVLATWQPYTTSKDGTAGIPNLQLYDVKTGTCLKSFIQKKMQNWCPSWSEDETLCARNVNNEV
HFFENNNFNTIANKLHLQKINDFVLSPGPQPYKVAVYVPGSKGAPSFVRLYQYPNFAGPHAALANKSFFKADKVT
MLWNKKATAVLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVYGFMPAKAT
IFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYKLISKPVASDSTYFAWCPDGEHILTA
TCAPRLRVNNGYKIWHYTGSILHKYDVPSNAELWQVSWQPFLDGIFPAKTITYQAVPSEVPNEEPKVATAYRPPA
LRNKPITNSKLHEEEPPQNMKPQSGNDKPLSKTALKNQRKHEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQ
SISGDPEIDKKIKNLKKKLKAIEQLKEQAATGKQLEKNQLEKIQKETALLQELEDLELGI
Structural information
Interpro:  IPR011387  IPR013979  IPR015943  IPR036322  

DIP:  

40272

MINT:  
STRING:   ENSP00000417229
Other Databases GeneCards:  EIF2A  Malacards:  EIF2A

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000049 tRNA binding
IBA molecular function
GO:0003743 translation initiation fa
ctor activity
IBA molecular function
GO:0043022 ribosome binding
IBA molecular function
GO:0022627 cytosolic small ribosomal
subunit
IBA cellular component
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006413 translational initiation
IEA biological process
GO:0006417 regulation of translation
IEA biological process
GO:0003743 translation initiation fa
ctor activity
IEA molecular function
GO:0006412 translation
IEA biological process
GO:0006413 translational initiation
IEA biological process
GO:0032933 SREBP signaling pathway
IEA biological process
GO:0006412 translation
IEA biological process
GO:1990928 response to amino acid st
arvation
IEA biological process
GO:0009967 positive regulation of si
gnal transduction
IEA biological process
GO:0006468 protein phosphorylation
IEA biological process
GO:0045296 cadherin binding
HDA molecular function
GO:0005850 eukaryotic translation in
itiation factor 2 complex
IDA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0042255 ribosome assembly
IMP biological process
GO:0005615 extracellular space
HDA cellular component
GO:0072562 blood microparticle
HDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0043022 ribosome binding
IMP molecular function
GO:0006417 regulation of translation
IMP biological process
GO:0003743 translation initiation fa
ctor activity
IMP molecular function
GO:0000049 tRNA binding
IMP molecular function
Associated diseases References
Hypospermatogenesis MIK: 28361989
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract