Search Result
Gene id | 83938 | ||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||
Gene Symbol | LRMDA Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||
Aliases | C10orf11, CDA017 | ||||||||||||||||||||||||||||||||
Gene name | leucine rich melanocyte differentiation associated | ||||||||||||||||||||||||||||||||
Alternate names | leucine-rich melanocyte differentiation-associated protein, leucine-rich repeat-containing protein C10orf11, | ||||||||||||||||||||||||||||||||
Gene location |
10q22.2-q22.3 (75431623: 76560167) Exons: 11 NC_000010.11 |
||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a leucine-rich repeat protein. The encoded protein is thought to play a role in melanocyte differentiation. Mutations in this gene have been associated with autosomal recessive oculocutaneous albinism 7 (OCA7). Alternatively spliced tran |
||||||||||||||||||||||||||||||||
OMIM | 617462 | ||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||
Protein general information | Q9H2I8 Name: Leucine rich melanocyte differentiation associated protein Length: 198 Mass: 22568 Tissue specificity: In the embryo, expressed in melanoblasts. In the fetus, expressed in melanocytes. Not detected in retinal pigment epithelial cells. {ECO | ||||||||||||||||||||||||||||||||
Sequence |
MEKYLSLSGNHSSNKRSLEGLSAFRSLEELILDNNQLGDDLVLPGLPRLHTLTLNKNRITDLENLLDHLAEVTPA LEYLSLLGNVACPNELVSLEKDEEDYKRYRCFVLYKLPNLKFLDAQKVTRQEREEALVRGVFMKVVKPKASSEDV ASSPERHYTPLPSASRELTSHQGVLGKCRYVYYGKNSEGNRFIRDDQL | ||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||
Other Databases | GeneCards: LRMDA Malacards: LRMDA | ||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||
|