• Gene id: 83933

Gene Summary

• Gene Symbol: HDAC10   Gene   UCSC   Ensembl
• Aliases: HD10
• Gene name: histone deacetylase 10
• Alternate names: polyamine deacetylase HDAC10,
• Gene location: 22q13.33 (50251264: 50245182)     Exons: 20     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in trans
• OMIM: 613335

Protein Summary

• Protein general information: Q969S8  
  • Name: Polyamine deacetylase HDAC10 (EC 3.5.1.48) (EC 3.5.1.62) (Histone deacetylase 10) (HD10)
  • Length: 669  
  • Mass: 71445
  • Tissue specificity: Widely expressed with high levels in liver and kidney. {ECO
• Sequence:

  MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEELGLVHSPEYVSLVRET
  QVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTGAVQNGLALVRPPGHHGQRAAANGFCVFNNV
  AIAAAHAKQKHGLHRILVVDWDVHHGQGIQYLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVN
  LPWNQVGMGNADYVAAFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
  LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQDVTAVPMSPSSHSPE
  GRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPDITLVLPPDVIQQEASALREETEAWARPHES
  LAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGR
  SLWLNIRGKEAAALSMFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
  AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKMLQCHPHLVA

• Structural information:
  • Interpro: IPR000286  IPR023801  IPR037138  IPR023696  
  • STRING: ENSP00000216271
• Other Databases: GeneCards:  HDAC10  Malacards:  HDAC10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0106048	spermidine deacetylation	IDA	biological process
GO:0006476	protein deacetylation	IDA	NOT|biological process
GO:0032425	positive regulation of mismatch repair	IDA	biological process
GO:0034983	peptidyl-lysine deacetylation	IDA	biological process
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0019213	deacetylase activity	IDA	molecular function
GO:0033558	protein deacetylase activity	IDA	NOT|molecular function
GO:0106047	polyamine deacetylation	IDA	biological process
GO:0008270	zinc ion binding	ISS	molecular function
GO:0035825	homologous recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016236	macroautophagy	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0047609	acetylputrescine deacetylase activity	IEA	molecular function
GO:0047611	acetylspermidine deacetylase activity	IEA	molecular function
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042826	histone deacetylase binding	IDA	molecular function
GO:0016575	histone deacetylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0006476	protein deacetylation	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006325	chromatin organization	NAS	biological process
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq