• Gene id: 83932

Gene Summary

• Gene Symbol: SPRTN   Gene   UCSC   Ensembl
• Aliases: C1orf124, DVC1, PRO4323, spartan
• Gene name: SprT-like N-terminal domain
• Alternate names: sprT-like domain-containing protein Spartan, DNA damage protein targeting VCP, DNA damage-targeting VCP (p97) adaptor, zinc finger RAD18 domain-containing protein,
• Gene location: 1q42.2 (231337979: 231355022)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene may play a role in DNA repair during replication of damaged DNA. This protein recruits valosin containing protein (p97) to stalled DNA replication forks where it may prevent excessive translesional DNA synthesis and limit
• OMIM: 610568

Protein Summary

• Protein general information: Q9H040  
  • Name: SprT like domain containing protein Spartan (DNA damage protein targeting VCP) (DVC1) (Protein with SprT like domain at the N terminus) (Spartan)
  • Length: 489  
  • Mass: 55134
• Sequence:

  MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLC
  AGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANIT
  VYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGK
  AKLGKEPVLAAENKDKPNRGEAQLVIPFSGKGYVLGETSNLPSPGKLITSHAINKTQDLLNQNHSANAVRPNSKI
  KVKFEQNGSSKNSHLVSPAVSNSHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSS
  KISLRNSSKVTESASVMPSQDVSGSEDTFPNKRPRLEDKTVFDNFFIKKEQIKSSGNDPKYSTTTAQNSSSSSSQ
  SKMVNCPVCQNEVLESQINEHLDWCLEGDSIKVKSEESL

• Structural information:
  • Protein Domains: (45..21-)
    (/note="SprT-like"-)
  • Interpro: IPR006640  IPR006642  
  • Prosite: PS51908 PS00142
  • PDB: 5IY4 6MDW 6MDX
  • PDBsum: 5IY4 6MDW 6MDX
  • STRING: ENSP00000295050
• Other Databases: GeneCards:  SPRTN  Malacards:  SPRTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006281	DNA repair	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0031593	polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0019985	translesion synthesis	IDA	biological process
GO:0019985	translesion synthesis	IDA	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0019985	translesion synthesis	IMP	biological process
GO:0019985	translesion synthesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Ruijs-Aalfs syndrome	KEGG:H02323
Ruijs-Aalfs syndrome	KEGG:H02323
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881