• Gene id: 83931

Gene Summary

• Gene Symbol: STK40   Gene   UCSC   Ensembl
• Aliases: SHIK, SgK495
• Gene name: serine/threonine kinase 40
• Alternate names: serine/threonine-protein kinase 40, SINK-homologous serine/threonine-protein kinase, Ser/Thr-like kinase, sugen kinase 495,
• Gene location: 1p34.3 (36385923: 36339627)     Exons: 12     NC_000001.11
• OMIM: 609437

Protein Summary

• Protein general information: Q8N2I9  
  • Name: Serine/threonine protein kinase 40 (EC 2.7.11.1) (SINK homologous serine/threonine protein kinase) (Sugen kinase 495) (SgK495)
  • Length: 435  
  • Mass: 49001
  • Tissue specificity: Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes. {ECO
• Sequence:

  MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTLEERGD
  QGIESQEERQGKMLLHTEYSLLSLLHTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLVLDCLCAHDFS
  DKTADLINLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKLGNMVLNKRTHRITITNFCLGKHLVS
  EGDLLKDQRGSPAYISPDVLSGRPYRGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVS
  ENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPDIDDQMSNADSSQEAKVTEECSQYEF
  ENYMRQQLLLAEEKSSIHDARSWVPKRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLRK

• Structural information:
  • Protein Domains: (35..33-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR024236  IPR008271  IPR024104  
  • Prosite: PS50011 PS00108
  • CDD: cd13974
  • PDB: 5L2Q
  • PDBsum: 5L2Q
  • STRING: ENSP00000362222
• Other Databases: GeneCards:  STK40  Malacards:  STK40

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043408	regulation of MAPK cascade	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0003016	respiratory system process	IEA	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0048286	lung alveolus development	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray