• Gene id: 83888

Gene Summary

• Gene Symbol: FGFBP2   Gene   UCSC   Ensembl
• Aliases: HBP17RP, KSP37
• Gene name: fibroblast growth factor binding protein 2
• Alternate names: fibroblast growth factor-binding protein 2, 37 kDa killer-specific secretory protein, FGF-BP2, FGF-binding protein 2, FGFBP-2, HBp17-RP, HBp17-related protein, killer-specific secretory protein of 37 kDa,
• Gene location: 4p15.32 (15963174: 15960244)     Exons: 2     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in t
• OMIM: 600243

Protein Summary

• Protein general information: Q9BYJ0  
  • Name: Fibroblast growth factor binding protein 2 (FGF BP2) (FGF binding protein 2) (FGFBP 2) (37 kDa killer specific secretory protein) (Ksp37) (HBp17 related protein) (HBp17 RP)
  • Length: 223  
  • Mass: 24581
  • Tissue specificity: Expressed in serum, peripheral leukocytes and cytotoxic T-lymphocytes, but not in granulocytes and monocytes (at protein level). {ECO
• Sequence:

  MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYR
  GQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSL
  RPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG

• Structural information:
  • Interpro: IPR010510  
  • STRING: ENSP00000259989
• Other Databases: GeneCards:  FGFBP2  Malacards:  FGFBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019838	growth factor binding	IBA	molecular function
GO:0007267	cell-cell signaling	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0019838	growth factor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881