• Gene id: 83884

Gene Summary

• Gene Symbol: SLC25A2   Gene   UCSC   Ensembl
• Aliases: ORC2, ORNT2
• Gene name: solute carrier family 25 member 2
• Alternate names: mitochondrial ornithine transporter 2, solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2,
• Gene location: 5q31.3 (141304048: 141302634)     Exons: 1     NC_000005.10
• Gene summary(Entrez): This intronless gene encodes a protein that localizes to the mitochondrial inner membrane and likely functions as a transporter of small molecules such as ornithine. This gene is located between the protocadherin beta and gamma gene clusters on chromosome
• OMIM: 606586

Protein Summary

• Protein general information: Q9BXI2  
  • Name: Mitochondrial ornithine transporter 2 (Solute carrier family 25 member 2)
  • Length: 301  
  • Mass: 32580
  • Tissue specificity: Expressed in liver, kidney, pancreas and cultured fibroblasts.
• Sequence:

  MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYV
  AENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSH
  NTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWL
  VVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
  Y

• Structural information:
  • Interpro: IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000239451
• Other Databases: GeneCards:  SLC25A2  Malacards:  SLC25A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990575	mitochondrial L-ornithine transmembrane transport	IBA	biological process
GO:0000064	L-ornithine transmembrane transporter activity	IBA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000050	urea cycle	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R