About Us

Search Result


Gene id 83871
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol RAB34   Gene   UCSC   Ensembl
Aliases NARR, RAB39, RAH
Gene name RAB34, member RAS oncogene family
Alternate names ras-related protein Rab-34, nine amino-acid residue-repeats, ras-related protein Rab-39, ras-related protein Rah,
Gene location 17q11.2 (28718439: 28714280)     Exons: 11     NC_000017.11
Gene summary(Entrez) This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the acti

Protein Summary

Protein general information P0DI83  

Name: Ras related protein Rab 34, isoform NARR (Nine amino acid residue repeats)

Length: 198  Mass: 21118

Sequence MVGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTPRARVI
LGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQGALQGRRQDEH
SGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI
Structural information
Other Databases GeneCards:  RAB34  Malacards:  RAB34
Protein general information Q9BZG1  

Name: Ras related protein Rab 34 (Ras related protein Rab 39) (Ras related protein Rah)

Length: 259  Mass: 29044

Sequence MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKD
TFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADA
LKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAEL
EKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
Structural information
Interpro:  IPR027417  IPR005225  IPR001806  
Prosite:   PS51419
MINT:  
STRING:   ENSP00000413156
Other Databases GeneCards:  RAB34  Malacards:  RAB34

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0030742 GTP-dependent protein bin
ding
IPI molecular function
GO:0032482 Rab protein signal transd
uction
IBA biological process
GO:0012505 endomembrane system
IBA cellular component
GO:0003924 GTPase activity
IBA molecular function
GO:0090385 phagosome-lysosome fusion
IBA biological process
GO:0006897 endocytosis
IBA biological process
GO:0006886 intracellular protein tra
nsport
IBA biological process
GO:0045335 phagocytic vesicle
IDA cellular component
GO:0090382 phagosome maturation
IMP biological process
GO:0045880 positive regulation of sm
oothened signaling pathwa
y
ISS biological process
GO:0090385 phagosome-lysosome fusion
IMP biological process
GO:0003924 GTPase activity
IEA molecular function
GO:0005525 GTP binding
IEA molecular function
GO:0031410 cytoplasmic vesicle
IEA cellular component
GO:0042995 cell projection
IEA cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0030030 cell projection organizat
ion
IEA biological process
GO:0005525 GTP binding
IEA molecular function
GO:0016020 membrane
IEA cellular component
GO:0000166 nucleotide binding
IEA molecular function
GO:0015031 protein transport
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0045335 phagocytic vesicle
IEA cellular component
GO:0005929 cilium
IEA cellular component
GO:0030670 phagocytic vesicle membra
ne
IEA cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0072659 protein localization to p
lasma membrane
IDA biological process
GO:0005795 Golgi stack
IDA cellular component
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular component
GO:0032587 ruffle membrane
IDA NOT|cellular component
GO:0032418 lysosome localization
IDA biological process
GO:0005794 Golgi apparatus
IDA cellular component
GO:0044351 macropinocytosis
IDA NOT|biological process
GO:0043001 Golgi to plasma membrane
protein transport
IDA biological process
GO:0031985 Golgi cisterna
IDA cellular component
GO:0031982 vesicle
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0070062 extracellular exosome
HDA cellular component
GO:0019882 antigen processing and pr
esentation
IMP biological process
GO:0017160 Ral GTPase binding
IPI molecular function
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Hypospermatogenesis MIK: 28361989
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract