• Gene id: 8387

Gene Summary

• Gene Symbol: OR1E1   Gene   UCSC   Ensembl
• Aliases: HGM071, OR13-66, OR17-2, OR17-32, OR1E5, OR1E6, OR1E8P, OR1E9P, OST547
• Gene name: olfactory receptor family 1 subfamily E member 1
• Alternate names: olfactory receptor 1E1, OR5-85, olfactory receptor 13-66, olfactory receptor 17-2/17-32, olfactory receptor 1E5, olfactory receptor 1E6, olfactory receptor 5-85, olfactory receptor OR17-18, olfactory receptor OR17-4, olfactory receptor, family 1, subfamily E, memb,
• Gene location: 17p13.3 (3398409: 3397103)     Exons: 1     NC_000017.11
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 123828

Protein Summary

• Protein general information: P30953  
  • Name: Olfactory receptor 1E1 (Olfactory receptor 13 66) (OR13 66) (Olfactory receptor 17 2/17 32) (OR17 2) (OR17 32) (Olfactory receptor 1E5) (Olfactory receptor 1E6) (Olfactory receptor 5 85) (OR5 85) (Olfactory receptor OR17 18) (Olfactory receptor like prote
  • Length: 314  
  • Mass: 35264
• Sequence:

  MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMYLFLSNLSFSDLCFSS
  VTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAYDRYVAICFPLHYTAIMSPMLCLALVALSWV
  LTTFHAMLHTLLMARLCFCADNVIPHFFCDMSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSI
  LKVPSSKGICKAFSTCGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA
  LSRVIHQKKTFFSL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000313384
• Other Databases: GeneCards:  OR1E1  Malacards:  OR1E1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007608	sensory perception of smell	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0007608	sensory perception of smell	NAS	biological process
GO:0004984	olfactory receptor activity	NAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007608	sensory perception of smell	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0007608	sensory perception of smell	NAS	biological process
GO:0004984	olfactory receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881