• Gene id: 83862

Gene Summary

• Gene Symbol: TMEM120A   Gene   UCSC   Ensembl
• Aliases: NET29, TMPIT
• Gene name: transmembrane protein 120A
• Alternate names: transmembrane protein 120A, transmembrane protein induced by tumor necrosis factor alpha,
• Gene location: 7q11.23 (75994668: 75986830)     Exons: 12     NC_000007.14
• OMIM: 616550

Protein Summary

• Protein general information: Q9BXJ8  
  • Name: Transmembrane protein 120A (Transmembrane protein induced by tumor necrosis factor alpha)
  • Length: 343  
  • Mass: 40610
• Sequence:

  MQPPPPGPLGDCLRDWEDLQQDFQNIQETHRLYRLKLEELTKLQNNCTSSITRQKKRLQELALALKKCKPSLPAE
  AEGAAQELENQMKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILILISFT
  CRFLLNSRVTDAAFNFLLVWYYCTLTIRESILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLS
  FSMYQSFVQFLQYYYQSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFNLAQDP
  QCKEWQVLMCGFPFLLLFLGNFFTTLRVVHHKFHSQRHGSKKD

• Structural information:
  • Interpro: IPR012926  
  • STRING: ENSP00000473983
• Other Databases: GeneCards:  TMEM120A  Malacards:  TMEM120A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045444	fat cell differentiation	IBA	biological process
GO:0051291	protein heterooligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	ISS	biological process
GO:0045444	fat cell differentiation	IMP	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005216	ion channel activity	ISS	molecular function
GO:0034220	ion transmembrane transport	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq