• Gene id: 83853

Gene Summary

• Gene Symbol: ROPN1L   Gene   UCSC   Ensembl
• Aliases: ASP, RSPH11
• Gene name: rhophilin associated tail protein 1 like
• Alternate names: ropporin-1-like protein, AKAP-associated sperm protein, ROPN1-like protein, radial spoke head 11 homolog,
• Gene location: 5p15.2 (10441861: 10482806)     Exons: 9     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the ropporin family. The encoded protein is present in sperm and interacts with A-kinase anchoring protein, AKAP3, through the amphipathic helix region of AKAP3. Alternatively spliced transcript variants have been found for t
• OMIM: 611756

Protein Summary

• Protein general information: Q96C74  
  • Name: Ropporin 1 like protein (ROPN1 like protein) (AKAP associated sperm protein)
  • Length: 230  
  • Mass: 26,107
• Sequence:

  MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLT
  QGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGSLNTALKHLCE
  ILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENS
  EDVGH

• Structural information:
  • Protein Domains: RIIa. (17-46)
  • STRING: ENSP00000274134
• Other Databases: GeneCards:  ROPN1L  Malacards:  ROPN1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003351	epithelial cilium movement	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031514	motile cilium	IDA	cellular component
GO:0003351	epithelial cilium movement	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031514	motile cilium	IDA	cellular component
GO:0003351	epithelial cilium movement	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0031514	motile cilium	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Causes defects in murine sperm motility	MIK: 23303679
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 25704993
Asthenozoospermia	MIK: 25704993
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25704993	Male infertility, Asthenozoospermia,			24 infertile asthenozoospermic	Male infertility	Ropporin
23303679	Causes defects in murine sperm motility				Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R