• Gene id: 8382

Gene Summary

• Gene Symbol: NME5   Gene   UCSC   Ensembl
• Aliases: NM23-H5, NM23H5, RSPH23
• Gene name: NME/NM23 family member 5
• Alternate names: nucleoside diphosphate kinase homolog 5, IPIA-beta, NDK-H 5, NDP kinase homolog 5, inhibitor of p53-induced apoptosis-beta, non-metastatic cells 5 protein expressed in, non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase), radial spoke 23,
• Gene location: 5q31.2 (18467389: 18484645)     Exons: 10     NC_000020.11
• OMIM: 603575

Protein Summary

• Protein general information: P56597  
  • Name: Nucleoside diphosphate kinase homolog 5 (NDK H 5) (NDP kinase homolog 5) (Inhibitor of p53 induced apoptosis beta) (IPIA beta) (Testis specific nm23 homolog) (nm23 H5)
  • Length: 212  
  • Mass: 24236
  • Tissue specificity: Specifically expressed in testis germinal cells.
• Sequence:

  MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNLTAYMS
  SGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMFPEVIVEP
  IPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEEPY

• Structural information:
  • Interpro: IPR007858  IPR034907  IPR036850  IPR012410  IPR001564  
  • STRING: ENSP00000265191
• Other Databases: GeneCards:  NME5  Malacards:  NME5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IBA	biological process
GO:0006228	UTP biosynthetic process	IEA	biological process
GO:0006241	CTP biosynthetic process	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	IEA	molecular function
GO:0006165	nucleoside diphosphate phosphorylation	IEA	biological process
GO:0006183	GTP biosynthetic process	IEA	biological process
GO:0048515	spermatid differentiation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0004550	nucleoside diphosphate kinase activity	TAS	molecular function
GO:0007283	spermatogenesis	TAS	biological process
GO:0009116	nucleoside metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003351	epithelial cilium movement involved in extracellular fluid movement	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0021591	ventricular system development	IEA	biological process
GO:0036126	sperm flagellum	IEA	cellular component
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0007286	spermatid development	ISS	biological process

Diseases

Associated diseases	References
Oligozoospermia	MIK: 21989496
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
21989496	Oligozoospermia			11 (8 infertile and 3 fertile men)	Male infertility	Microarray