• Gene id: 83759

Gene Summary

• Gene Symbol: RBM4B   Gene   UCSC   Ensembl
• Aliases: RBM30, RBM4L, ZCCHC15, ZCCHC21B, ZCRB3B
• Gene name: RNA binding motif protein 4B
• Alternate names: RNA-binding protein 4B, RNA-binding motif protein 30, zinc finger CCHC-type and RNA binding motif 3B,
• Gene location: 11q13.2 (153671027: 153661787)     Exons: 14     NC_000001.11

Protein Summary

• Protein general information: Q9BQ04  
  • Name: RNA binding protein 4B (RNA binding motif protein 30) (RNA binding motif protein 4B) (RNA binding protein 30)
  • Length: 359  
  • Mass: 40150
  • Tissue specificity: Expressed in liver and kidney (at protein level). Ubiquitously expressed. {ECO
• Sequence:

  MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEASKNKSK
  ASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRMHVQLSTSRL
  RTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYR
  VRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSGAAATSAAMAAAAATTSSYYG
  RDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQYVDRARYSAF

• Structural information:
  • Protein Domains: (2..7-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (78..14-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR034897  IPR034898  IPR000504   IPR001878  
  • Prosite: PS50102 PS50158
  • CDD: cd12606 cd12607
  • PDB: 2DGT
  • PDBsum: 2DGT
  • STRING: ENSP00000433071
• Other Databases: GeneCards:  RBM4B  Malacards:  RBM4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0003729	mRNA binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016607	nuclear speck	IBA	cellular component
GO:0045292	mRNA cis splicing, via spliceosome	IBA	biological process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological process
GO:0006417	regulation of translation	ISS	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043153	entrainment of circadian clock by photoperiod	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R