• Gene id: 83758

Gene Summary

• Gene Symbol: RBP5   Gene   UCSC   Ensembl
• Aliases: CRBP-III, CRBP3, CRBPIII, HRBPiso
• Gene name: retinol binding protein 5
• Alternate names: retinol-binding protein 5, cellular retinol-binding protein III, putative cellular retinol-binding protein CRBP III, retinol binding protein 5, cellular,
• Gene location: 12p13.31 (63653609: 63639704)     Exons: 6     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a cellular retinol-binding protein expressed highly in kidney and liver. Down-regulation of the encoded protein in hepatocellular carcinoma was associated with large tumor size and poor patient survival rates. [provided
• OMIM: 611866

Protein Summary

• Protein general information: P82980  
  • Name: Retinol binding protein 5 (Cellular retinol binding protein III) (CRBP III) (HRBPiso)
  • Length: 135  
  • Mass: 15931
  • Tissue specificity: Higher expression in adult kidney and liver and to a lesser extent in adult and fetal spleen, adult lymph nodes and appendix, and fetal liver and kidney. Strongly decreased in hepatocellular carcinoma tissues (at protein level). {ECO
• Sequence:

  MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDL
  RSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

• Structural information:
  • Interpro: IPR012674  IPR031270  IPR000463  IPR031259  IPR000566  
  • PDB: 1GGL 6E5W
  • PDBsum: 1GGL 6E5W
  • STRING: ENSP00000266560
• Other Databases: GeneCards:  RBP5  Malacards:  RBP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0016918	retinal binding	IEA	molecular function
GO:0016918	retinal binding	IEA	molecular function
GO:0019841	retinol binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005501	retinoid binding	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray