• Gene id: 83756

Gene Summary

• Gene Symbol: TAS1R3   Gene   UCSC   Ensembl
• Aliases: T1R3
• Gene name: taste 1 receptor member 3
• Alternate names: taste receptor type 1 member 3, sweet taste receptor T1R3, taste receptor, type 1, member 3,
• Gene location: 1p36.33 (1331279: 1335319)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a G-protein coupled receptor involved in taste responses. The encoded protein can form a heterodimeric receptor with TAS1R1 to elicit the umami taste response, or it can bind with TAS1R2 to form a receptor for the sweet
• OMIM: 608081

Protein Summary

• Protein general information: Q7RTX0  
  • Name: Taste receptor type 1 member 3 (Sweet taste receptor T1R3)
  • Length: 852  
  • Mass: 93386
• Sequence:

  MLGPAVLGLSLWALLHPGTGAPLCLSQQLRMKGDYVLGGLFPLGEAEEAGLRSRTRPSSPVCTRFSSNGLLWALA
  MKMAVEEINNKSDLLPGLRLGYDLFDTCSEPVVAMKPSLMFLAKAGSRDIAAYCNYTQYQPRVLAVIGPHSSELA
  MVTGKFFSFFLMPQVSYGASMELLSARETFPSFFRTVPSDRVQLTAAAELLQEFGWNWVAALGSDDEYGRQGLSI
  FSALAAARGICIAHEGLVPLPRADDSRLGKVQDVLHQVNQSSVQVVLLFASVHAAHALFNYSISSRLSPKVWVAS
  EAWLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAFCSALGEREQGLEEDVVGQRCPQCDC
  ITLQNVSAGLNHHQTFSVYAAVYSVAQALHNTLQCNASGCPAQDPVKPWQLLENMYNLTFHVGGLPLRFDSSGNV
  DMEYDLKLWVWQGSVPRLHDVGRFNGSLRTERLKIRWHTSDNQKPVSRCSRQCQEGQVRRVKGFHSCCYDCVDCE
  AGSYRQNPDDIACTFCGQDEWSPERSTRCFRRRSRFLAWGEPAVLLLLLLLSLALGLVLAALGLFVHHRDSPLVQ
  ASGGPLACFGLVCLGLVCLSVLLFPGQPSPARCLAQQPLSHLPLTGCLSTLFLQAAEIFVESELPLSWADRLSGC
  LRGPWAWLVVLLAMLVEVALCTWYLVAFPPEVVTDWHMLPTEALVHCRTRSWVSFGLAHATNATLAFLCFLGTFL
  VRSQPGCYNRARGLTFAMLAYFITWVSFVPLLANVQVVLRPAVQMGALLLCVLGILAAFHLPRCYLLMRQPGLNT
  PEFFLGGGPGDAQGQNDGNTGNQGKHE

• Structural information:
  • Interpro: IPR001828  IPR000337  IPR011500  IPR038550  IPR017978   IPR000068  IPR017979  IPR028082  
  • Prosite: PS00980 PS50259
  • STRING: ENSP00000344411
• Other Databases: GeneCards:  TAS1R3  Malacards:  TAS1R3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008527	taste receptor activity	IDA	contributes to
GO:0007186	G protein-coupled receptor signaling pathway	IC	biological process
GO:0033041	sweet taste receptor activity	IDA	contributes to
GO:0001582	detection of chemical stimulus involved in sensory perception of sweet taste	IDA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0050917	sensory perception of umami taste	IBA	biological process
GO:0050916	sensory perception of sweet taste	IBA	biological process
GO:0033041	sweet taste receptor activity	IBA	contributes to
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0050916	sensory perception of sweet taste	IEA	biological process
GO:0008527	taste receptor activity	IEA	molecular function
GO:0050916	sensory perception of sweet taste	IEA	biological process
GO:0050917	sensory perception of umami taste	IEA	biological process
GO:1903767	sweet taste receptor complex	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050917	sensory perception of umami taste	IDA	biological process
GO:0050916	sensory perception of sweet taste	IDA	biological process
GO:0050916	sensory perception of sweet taste	IDA	biological process
GO:0050916	sensory perception of sweet taste	IDA	biological process
GO:0016021	integral component of membrane	IC	cellular component
GO:0008527	taste receptor activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04742	Taste transduction
hsa04973	Carbohydrate digestion and absorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq