• Gene id: 83743

Gene Summary

• Gene Symbol: GRWD1   Gene   UCSC   Ensembl
• Aliases: CDW4, GRWD, RRB1, WDR28
• Gene name: glutamate rich WD repeat containing 1
• Alternate names: glutamate-rich WD repeat-containing protein 1, CUL4- and DDB1-associated WDR protein 4, WD repeat domain 28, glutamate rich WD repeat protein GRWD, regulator of ribosome biogenesis 1 homolog,
• Gene location: 19q13.33 (48445982: 48457021)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a glutamate-rich protein that contains five WD-repeat motifs. The encoded protein may play a critical role in ribosome biogenesis and may also play a role in histone methylation through interactions with CUL4-DDB1 ubiquitin E3 ligase. [p
• OMIM: 611461

Protein Summary

• Protein general information: Q9BQ67  
  • Name: Glutamate rich WD repeat containing protein 1
  • Length: 446  
  • Mass: 49419
• Sequence:

  MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFDIVRDH
  LGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYG
  GINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPR
  VTGRLLTGDCQKNIHLWTPTDGGSWHVDQRPFVGHTRSVEDLQWSPTENTVFASCSADASIRIWDIRAAPSKACM
  LTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFKQHVAPVTSVEWHPQDSGVFAASGAD
  HQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKELHWHPQCPGLLVSTALSGFTIFRTISV

• Structural information:
  • Interpro: IPR020472  IPR022052  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000253237
• Other Databases: GeneCards:  GRWD1  Malacards:  GRWD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006334	nucleosome assembly	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0003688	DNA replication origin binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006260	DNA replication	IMP	biological process
GO:0006334	nucleosome assembly	IMP	biological process
GO:0006337	nucleosome disassembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006334	nucleosome assembly	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0003688	DNA replication origin binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006260	DNA replication	IMP	biological process
GO:0006334	nucleosome assembly	IMP	biological process
GO:0006337	nucleosome disassembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq