• Gene id: 83734

Gene Summary

• Gene Symbol: ATG10   Gene   UCSC   Ensembl
• Aliases: APG10, APG10L, pp12616
• Gene name: autophagy related 10
• Alternate names: ubiquitin-like-conjugating enzyme ATG10, APG10 autophagy 10-like, ATG10 autophagy related 10 homolog, autophagy-related protein 10,
• Gene location: 5q14.1-q14.2 (81972020: 82258501)     Exons: 13     NC_000005.10
• Gene summary(Entrez): Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modif
• OMIM: 610800

Protein Summary

• Protein general information: Q9H0Y0  
  • Name: Ubiquitin like conjugating enzyme ATG10 (EC 2.3.2. ) (Autophagy related protein 10) (APG10 like)
  • Length: 220  
  • Mass: 25279
• Sequence:

  MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAF
  ELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQ
  QEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

• Structural information:
  • Interpro: IPR007135  
  • STRING: ENSP00000282185
• Other Databases: GeneCards:  ATG10  Malacards:  ATG10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032446	protein modification by small protein conjugation	IBA	biological process
GO:0019777	Atg12 transferase activity	IBA	molecular function
GO:0016236	macroautophagy	IBA	biological process
GO:0006914	autophagy	IBA	biological process
GO:0006497	protein lipidation	IBA	biological process
GO:0019777	Atg12 transferase activity	ISS	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006983	ER overload response	IMP	biological process
GO:0006914	autophagy	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IMP	biological process
GO:0032446	protein modification by small protein conjugation	IDA	biological process
GO:0031401	positive regulation of protein modification process	ISS	biological process
GO:0006914	autophagy	IMP	biological process
GO:0006497	protein lipidation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq