• Gene id: 8372

Gene Summary

• Gene Symbol: HYAL3   Gene   UCSC   Ensembl
• Aliases: HYAL-3, LUCA-3, LUCA3
• Gene name: hyaluronidase 3
• Alternate names: hyaluronidase-3, hyaluronoglucosaminidase 3, lung carcinoma protein 3,
• Gene location: 3p21.31 (50299404: 50292831)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the hyaluronidase family. Hyaluronidases are endoglycosidase enzymes that degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. The regulated turnover of hyaluronan plays a critical role in many
• OMIM: 604038

Protein Summary

• Protein general information: O43820  
  • Name: Hyaluronidase 3 (Hyal 3) (EC 3.2.1.35) (Hyaluronoglucosaminidase 3) (Lung carcinoma protein 3) (LuCa 3)
  • Length: 417  
  • Mass: 46501
  • Tissue specificity: Expressed in sperm (PubMed
• Sequence:

  MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIANRGQHFHGQNMTIFYK
  NQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASW
  AWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATL
  ARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
  LVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQM
  EAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV

• Structural information:
  • Protein Domains: (352..40-)
    (/note="EGF-like"-)
  • Interpro: IPR013785  IPR017853  IPR018155  IPR027260  
  • Prosite: PS00022 PS01186
  • STRING: ENSP00000337425
• Other Databases: GeneCards:  HYAL3  Malacards:  HYAL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0030214	hyaluronan catabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007338	single fertilization	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000368	positive regulation of acrosomal vesicle exocytosis	IEA	biological process
GO:0097225	sperm midpiece	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030214	hyaluronan catabolic process	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0007341	penetration of zona pellucida	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004415	hyalurononglucosaminidase activity	IEA	molecular function
GO:0001552	ovarian follicle atresia	IEA	biological process
GO:2000355	negative regulation of ovarian follicle development	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0009615	response to virus	IDA	biological process
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0071493	cellular response to UV-B	IDA	biological process
GO:0071347	cellular response to interleukin-1	IDA	biological process
GO:0033906	hyaluronoglucuronidase activity	IDA	molecular function
GO:0006954	inflammatory response	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0001618	virus receptor activity	IDA	NOT|molecular function
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0051216	cartilage development	IEP	biological process
GO:0046677	response to antibiotic	IEP	biological process
GO:2000368	positive regulation of acrosomal vesicle exocytosis	ISS	biological process
GO:2000355	negative regulation of ovarian follicle development	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0007341	penetration of zona pellucida	ISS	biological process
GO:0001669	acrosomal vesicle	ISS	cellular component
GO:0002080	acrosomal membrane	ISS	cellular component
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0097225	sperm midpiece	ISS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0001552	ovarian follicle atresia	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04142	Lysosome
hsa00531	Glycosaminoglycan degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray