• Gene id: 83700

Gene Summary

• Gene Symbol: JAM3   Gene   UCSC   Ensembl
• Aliases: JAM-2, JAM-3, JAM-C, JAMC
• Gene name: junctional adhesion molecule 3
• Alternate names: junctional adhesion molecule C,
• Gene location: 11q25 (68206128: 68257163)     Exons: 10     NC_000017.11
• Gene summary(Entrez): Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.
• OMIM: 606871

Protein Summary

• Protein general information: Q9BX67  
  • Name: Junctional adhesion molecule C (JAM C) (JAM 2) (Junctional adhesion molecule 3) (JAM 3) [Cleaved into: Soluble form of JAM C (sJAM C)]
  • Length: 310  
  • Mass: 35020
  • Tissue specificity: Detected on round and elongated spermatids (at protein level) (PubMed
• Sequence:

  MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQT
  TYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAV
  PVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDA
  GSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEG
  DFRHKSSFVI

• Structural information:
  • Protein Domains: (35..12-)
    (/note="Ig-like-V-type)
    (139..23-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR042974  
  • Prosite: PS50835
  • STRING: ENSP00000299106
• Other Databases: GeneCards:  JAM3  Malacards:  JAM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098632	cell-cell adhesion mediator activity	IDA	molecular function
GO:0098632	cell-cell adhesion mediator activity	IDA	molecular function
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0005902	microvillus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031941	filamentous actin	IDA	cellular component
GO:0070160	tight junction	IDA	cellular component
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034113	heterotypic cell-cell adhesion	IDA	biological process
GO:0097530	granulocyte migration	IMP	biological process
GO:0045176	apical protein localization	IMP	biological process
GO:0005911	cell-cell junction	IMP	cellular component
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:1902414	protein localization to cell junction	IMP	biological process
GO:0033629	negative regulation of cell adhesion mediated by integrin	IMP	biological process
GO:0034333	adherens junction assembly	IMP	biological process
GO:0033624	negative regulation of integrin activation	IMP	biological process
GO:0034394	protein localization to cell surface	IMP	biological process
GO:0098636	protein complex involved in cell adhesion	IDA	cellular component
GO:0005923	bicellular tight junction	IDA	colocalizes with
GO:0030057	desmosome	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0001525	angiogenesis	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0090022	regulation of neutrophil chemotaxis	IDA	biological process
GO:0044291	cell-cell contact zone	IDA	cellular component
GO:0098609	cell-cell adhesion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097241	hematopoietic stem cell migration to bone marrow	IMP	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097241	hematopoietic stem cell migration to bone marrow	IEA	biological process
GO:0043220	Schmidt-Lanterman incisure	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0033010	paranodal junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005178	integrin binding	IEA	molecular function
GO:0002318	myeloid progenitor cell differentiation	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0031103	axon regeneration	IEA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0090138	regulation of actin cytoskeleton organization by cell-cell adhesion	IEA	biological process
GO:0042552	myelination	IEA	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0019226	transmission of nerve impulse	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0002523	leukocyte migration involved in inflammatory response	IEA	biological process
GO:0001780	neutrophil homeostasis	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030057	desmosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration
hsa05120	Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Hemorrhagic destruction of the brain, subependymal calcification, and cataracts	KEGG:H01301
Hemorrhagic destruction of the brain, subependymal calcification, and cataracts	KEGG:H01301
systemic scleroderma	PMID:23001478
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881