• Gene id: 83695

Gene Summary

• Gene Symbol: RHNO1   Gene   UCSC   Ensembl
• Aliases: C12orf32, HKMT1188, RHINO
• Gene name: RAD9-HUS1-RAD1 interacting nuclear orphan 1
• Alternate names: RAD9, HUS1, RAD1-interacting nuclear orphan protein 1, Rad9, Rad1, Hus1 interacting nuclear orphan, rAD9, RAD1, HUS1-interacting nuclear orphan protein,
• Gene location: 12p13.33 (2876264: 2889524)     Exons: 5     NC_000012.12
• OMIM: 609516

Protein Summary

• Protein general information: Q9BSD3  
  • Name: RAD9, HUS1, RAD1 interacting nuclear orphan protein 1 (RAD9, RAD1, HUS1 interacting nuclear orphan protein)
  • Length: 238  
  • Mass: 26709
  • Tissue specificity: Weakly expressed in testis, prostate, ovary, thymus and small intestine. Expressed strongly in breast cancer cells. {ECO
• Sequence:

  MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKH
  QNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPY
  VFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRE
  RGKLSRSQFLVKS

• Structural information:
  • Interpro: IPR029293  
  • PDB: 6J8Y
  • PDBsum: 6J8Y
  • STRING: ENSP00000479598
• Other Databases: GeneCards:  RHNO1  Malacards:  RHNO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0005694	chromosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070318	positive regulation of G0 to G1 transition	IMP	biological process
GO:0000077	DNA damage checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000725	recombinational repair	IMP	biological process
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0071479	cellular response to ionizing radiation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray