• Gene id: 83692

Gene Summary

• Gene Symbol: CD99L2   Gene   UCSC   Ensembl
• Aliases: CD99B, MIC2L1
• Gene name: CD99 molecule like 2
• Alternate names: CD99 antigen-like protein 2, MIC2 like 1, MIC2-like protein 1,
• Gene location: Xq28 (150898815: 150766335)     Exons: 21     NC_000023.11
• Gene summary(Entrez): This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
• OMIM: 300846

Protein Summary

• Protein general information: Q8TCZ2  
  • Name: CD99 antigen like protein 2 (MIC2 like protein 1) (CD antigen CD99)
  • Length: 262  
  • Mass: 27986
  • Tissue specificity: Expressed in many tissues, with low expression in thymus. {ECO
• Sequence:

  MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLAD
  ALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDL
  EDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADY
  VKGENLEAVVCEEPQVKYSTLHTQSAEPPPPPEPARI

• Structural information:
  • Interpro: IPR022078  
  • STRING: ENSP00000480322
• Other Databases: GeneCards:  CD99L2  Malacards:  CD99L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030054	cell junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000409	positive regulation of T cell extravasation	IEA	biological process
GO:0005912	adherens junction	IEA	cellular component
GO:2000391	positive regulation of neutrophil extravasation	IEA	biological process
GO:0050904	diapedesis	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray