• Gene id: 8369

Gene Summary

• Gene Symbol: H4C7   Gene   UCSC   Ensembl
• Aliases: H4/l, H4FL, HIST1H4G
• Gene name: H4 clustered histone 7
• Alternate names: histone H4-like protein type G, H4 histone family, member L, histone 1, H4g, histone cluster 1 H4 family member g, histone cluster 1, H4g,
• Gene location: 6p22.2 (26246995: 26246610)     Exons: 1     NC_000006.12
• Gene summary(Entrez): Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
• OMIM: 607295

Protein Summary

• Protein general information: Q99525  
  • Name: Histone H4 like protein type G (H4 clustered histone 7)
  • Length: 98  
  • Mass: 11009
• Sequence:

  MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFKVFLENVIWYAVTNTE
  HAKRKTVTAMAVVYVLKRQGRTL

• Structural information:
  • Interpro: IPR009072  IPR001951  
  • STRING: ENSP00000477870
• Other Databases: GeneCards:  H4C7  Malacards:  H4C7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006334	nucleosome assembly	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0000786	nucleosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005634	nucleus	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa05322	Systemic lupus erythematosus

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881