• Gene id: 83667

Gene Summary

• Gene Symbol: SESN2   Gene   UCSC   Ensembl
• Aliases: HI95, SES2, SEST2
• Gene name: sestrin 2
• Alternate names: sestrin-2, hypoxia induced gene 95, hypoxia-induced,
• Gene location: 1p35.3 (28259451: 28282490)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the sestrin family of PA26-related proteins. The encoded protein may function in the regulation of cell growth and survival. This protein may be involved in cellular response to different stress conditions. [provided by RefSe
• OMIM: 177061

Protein Summary

• Protein general information: P58004  
  • Name: Sestrin 2 (EC 1.11.1.15) (Hypoxia induced gene)
  • Length: 480  
  • Mass: 54494
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGR
  VDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLH
  RAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGS
  PAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
  ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTY
  NTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHS
  EKVHVNLLLLEARMQAALLYALRAITRYMT

• Structural information:
  • Interpro: IPR029032  IPR006730  
  • PDB: 5CUF 5DJ4 5T0N 6N0M
  • PDBsum: 5CUF 5DJ4 5T0N 6N0M
  • DIP: 62044
  • STRING: ENSP00000253063
• Other Databases: GeneCards:  SESN2  Malacards:  SESN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016239	positive regulation of macroautophagy	IBA	biological process
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IBA	molecular function
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:0071233	cellular response to leucine	IBA	biological process
GO:0031932	TORC2 complex	IBA	colocalizes with
GO:0061700	GATOR2 complex	IBA	colocalizes with
GO:0070728	leucine binding	IBA	molecular function
GO:1904262	negative regulation of TORC1 signaling	IBA	biological process
GO:1990253	cellular response to leucine starvation	IBA	biological process
GO:0032542	sulfiredoxin activity	IDA	molecular function
GO:0032542	sulfiredoxin activity	IDA	NOT|molecular function
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IDA	molecular function
GO:0001932	regulation of protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0070728	leucine binding	IDA	molecular function
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:1990316	Atg1/ULK1 kinase complex	IDA	colocalizes with
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:0098869	cellular oxidant detoxification	IDA	NOT|biological process
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:0070728	leucine binding	IDA	molecular function
GO:0061700	GATOR2 complex	IDA	colocalizes with
GO:0098869	cellular oxidant detoxification	IDA	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0030308	negative regulation of cell growth	ISS	biological process
GO:0042149	cellular response to glucose starvation	IMP	biological process
GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	IMP	biological process
GO:0016239	positive regulation of macroautophagy	IMP	biological process
GO:1902010	negative regulation of translation in response to endoplasmic reticulum stress	IMP	biological process
GO:0071233	cellular response to leucine	IMP	biological process
GO:0071230	cellular response to amino acid stimulus	IMP	biological process
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:0031932	TORC2 complex	ISS	colocalizes with
GO:0031588	nucleotide-activated protein kinase complex	ISS	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0072593	reactive oxygen species metabolic process	IMP	biological process
GO:1900182	positive regulation of protein localization to nucleus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098869	cellular oxidant detoxification	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:1990253	cellular response to leucine starvation	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:1904262	negative regulation of TORC1 signaling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:1901031	regulation of response to reactive oxygen species	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902010	negative regulation of translation in response to endoplasmic reticulum stress	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0070328	triglyceride homeostasis	IEA	biological process
GO:0046323	glucose import	IEA	biological process
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0032042	mitochondrial DNA metabolic process	IEA	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0007005	mitochondrion organization	IEA	biological process
GO:0006635	fatty acid beta-oxidation	IEA	biological process
GO:2000479	regulation of cAMP-dependent protein kinase activity	IEA	biological process
GO:1904504	positive regulation of lipophagy	IEA	biological process
GO:1904262	negative regulation of TORC1 signaling	IEA	biological process
GO:0031932	TORC2 complex	IEA	cellular component
GO:0031588	nucleotide-activated protein kinase complex	IEA	cellular component
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IEA	biological process
GO:0006111	regulation of gluconeogenesis	IEA	biological process
GO:0005092	GDP-dissociation inhibitor activity	IEA	molecular function
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway
hsa04211	Longevity regulating pathway
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq