• Gene id: 83657

Gene Summary

• Gene Symbol: DYNLRB2   Gene   UCSC   Ensembl
• Aliases: DNCL2B, DNLC2B, ROBLD2
• Gene name: dynein light chain roadblock-type 2
• Alternate names: dynein light chain roadblock-type 2, bithoraxoid-like protein, dynein light chain 2B, cytoplasmic, dynein, cytoplasmic, light polypeptide 2B, roadblock domain-containing protein 2, testicular tissue protein Li 53,
• Gene location: 16q23.2 (80540258: 80550810)     Exons: 8     NC_000016.10
• OMIM: 607168

Protein Summary

• Protein general information: Q8TF09  
  • Name: Dynein light chain roadblock type 2 (Dynein light chain 2B, cytoplasmic) (Roadblock domain containing protein 2)
  • Length: 96  
  • Mass: 10855
  • Tissue specificity: High expression in heart, brain, placenta, skeletal muscle, prostate and small intestine; moderate in kidney, pancreas, spleen, testis, ovary and colon; low in lung, liver, thymus and leukocyte.
• Sequence:

  MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKK
  HEIMVAPDKEYLLIVIQNPCE

• Structural information:
  • Interpro: IPR016561  IPR004942  
  • STRING: ENSP00000302936
• Other Databases: GeneCards:  DYNLRB2  Malacards:  DYNLRB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003774	motor activity	IEA	molecular function
GO:0030286	dynein complex	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0035735	intraciliary transport involved in cilium assembly	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007018	microtubule-based movement	NAS	biological process
GO:0005868	cytoplasmic dynein complex	NAS	cellular component
GO:0003777	microtubule motor activity	NAS	molecular function
GO:0045505	dynein intermediate chain binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005868	cytoplasmic dynein complex	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:11750132
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 18367176
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
18367176	Male infertility				Male infertility	Microarray