• Gene id: 83650

Gene Summary

• Gene Symbol: SLC35G5   Gene   UCSC   Ensembl
• Aliases: AMAC, AMAC1L2
• Gene name: solute carrier family 35 member G5
• Alternate names: solute carrier family 35 member G5, acyl-malonyl condensing enzyme 1-like 2, acyl-malonyl-condensing enzyme 1-like protein 2, protein AMAC1L2,
• Gene location: 8p23.1 (11331011: 11332359)     Exons: 1     NC_000008.11
• Gene summary(Entrez): This gene is intronless and probably arose from retrotransposition of a similar gene. It has high sequence similarity to the gene encoding acyl-malonyl condensing enzyme on chromosome 17. [provided by RefSeq, Aug 2011]
• OMIM: 615199

Protein Summary

• Protein general information: Q96KT7  
  • Name: Solute carrier family 35 member G5 (Acyl malonyl condensing enzyme 1 like protein 2)
  • Length: 338  
  • Mass: 35161
  • Tissue specificity: Expressed in placenta and testis. {ECO
• Sequence:

  MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRMAYQGSNLPSLELLIC
  RCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTVCSAVLTLCLE
  SQGLGGYEWCGLLGSILGLIIILGPGLWTLQEGTTGVYTTLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFL
  SGLVGLLGCVPGLFVLQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYM
  LHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE

• Structural information:
  • Protein Domains: (49..17-)
    (/note="EamA-1)
    (272..32-)
    (/note="EamA-2")
  • STRING: ENSP00000371872
• Other Databases: GeneCards:  SLC35G5  Malacards:  SLC35G5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)