Search Result
Gene id | 83648 | ||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
Gene Symbol | FAM167A Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
Aliases | C8orf13, D8S265, DIORA-1 | ||||||||||||||||||||||||||||||||||||||||
Gene name | family with sequence similarity 167 member A | ||||||||||||||||||||||||||||||||||||||||
Alternate names | protein FAM167A, disordered autoimmunity 1, | ||||||||||||||||||||||||||||||||||||||||
Gene location |
8p23.1 (11475908: 11421464) Exons: 9 NC_000008.11 |
||||||||||||||||||||||||||||||||||||||||
OMIM | 610085 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
Protein general information | Q96KS9 Name: Protein FAM167A Length: 214 Mass: 24182 Tissue specificity: Expressed in skin, including primary keratinocytes, spleen, kidney, leukocytes, testis, lung, small intestine and prostate. {ECO | ||||||||||||||||||||||||||||||||||||||||
Sequence |
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQASLEEGE RGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKELTEMRLQDQQLARQLMRLRGDINK LKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFSLC | ||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: FAM167A  Malacards: FAM167A | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
|