• Gene id: 83640

Gene Summary

• Gene Symbol: RAMAC   Gene   UCSC   Ensembl
• Aliases: C15orf18, FAM103A1, HsT19360, RAM, RAMMET
• Gene name: RNA guanine-7 methyltransferase activating subunit
• Alternate names: RNA guanine-N7 methyltransferase activating subunit, RNMT activating mRNA cap methyltransferase subunit, RNMT-activating mini protein, family with sequence similarity 103 member A1, protein FAM103A1,
• Gene location: 15q25.2 (82986209: 82991056)     Exons: 4     NC_000015.10
• OMIM: 614547

Protein Summary

• Protein general information: Q9BTL3  
  • Name: RNA guanine N7 methyltransferase activating subunit (Protein FAM103A1) (RNA guanine 7 methyltransferase activating subunit) (RNMT activating mRNA cap methyltransferase subunit) (RNMT activating mini protein) (RAM)
  • Length: 118  
  • Mass: 14381
• Sequence:

  MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQDNRQFRGRDNRWGWPS
  DNRSNQWHGRSWGNNYPQHRQEPYYPQQYGHYGYNQRPPYGYY

• Structural information:
  • Interpro: IPR028271  
  • PDB: 5E8J
  • PDBsum: 5E8J
  • STRING: ENSP00000307181
• Other Databases: GeneCards:  RAMAC  Malacards:  RAMAC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031533	mRNA cap methyltransferase complex	IDA	cellular component
GO:0006370	7-methylguanosine mRNA capping	IDA	biological process
GO:0004482	mRNA (guanine-N7-)-methyltransferase activity	IDA	contributes to
GO:0036031	recruitment of mRNA capping enzyme to RNA polymerase II holoenzyme complex	IDA	biological process
GO:0005845	mRNA cap binding complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0032259	methylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0106005	RNA 5'-cap (guanine-N7)-methylation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005845	mRNA cap binding complex	IEA	cellular component
GO:0006370	7-methylguanosine mRNA capping	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq