• Gene id: 83637

Gene Summary

• Gene Symbol: ZMIZ2   Gene   UCSC   Ensembl
• Aliases: NET27, TRAFIP20, ZIMP7, hZIMP7
• Gene name: zinc finger MIZ-type containing 2
• Alternate names: zinc finger MIZ domain-containing protein 2, PIAS-like protein Zimp7,
• Gene location: 7p13 (44748546: 44769880)     Exons: 24     NC_000007.14
• Gene summary(Entrez): ZMIZ2 and ZMIZ1 (MIM 607159) are members of a PIAS (see MIM 603566)-like family of proteins that interact with nuclear hormone receptors. ZMIZ2 interacts with androgen receptor (AR; MIM 313700) and enhances AR-mediated transcription (Huang et al., 2005 [P
• OMIM: 607917

Protein Summary

• Protein general information: Q8NF64  
  • Name: Zinc finger MIZ domain containing protein 2 (PIAS like protein Zimp7)
  • Length: 920  
  • Mass: 96537
  • Tissue specificity: Expressed most abundantly in testis with lower levels in heart, brain, pancreas, prostate and ovary. {ECO
• Sequence:

  MNSMNPMKPALPPAPHGDGSFAYESVPWQQSATQPAGSLSVVTTVWGVGNATQSQVLGNPMGPAGSPSGSSMMPG
  VAGGSSALTSPQCLGQQAFAEGGANKGYVQQGVYSRGGYPGAPGFTTGYAGGPGGLGLPSHAARPSTDFTQAAAA
  AAVAAAAATATATATATVAALQEKQSQELSQYGAMGAGQSFNSQFLQHGGPRGPSVPAGMNPTGIGGVMGPSGLS
  PLAMNPTRAAGMTPLYAGQRLPQHGYPGPPQAQPLPRQGVKRTYSEVYPGQQYLQGGQYAPSTAQFAPSPGQPPA
  PSPSYPGHRLPLQQGMTQSLSVPGPTGLHYKPTEQFNGQGASFNGGSVSYSQPGLSGPTRSIPGYPSSPLPGNPT
  PPMTPSSSVPYMSPNQEVKSPFLPDLKPNLNSLHSSPSGSGPCDELRLTFPVRDGVVLEPFRLQHNLAVSNHVFQ
  LRDSVYKTLIMRPDLELQFKCYHHEDRQMNTNWPASVQVSVNATPLTIERGDNKTSHKPLYLKHVCQPGRNTIQI
  TVTACCCSHLFVLQLVHRPSVRSVLQGLLKKRLLPAEHCITKIKRNFSSGTIPGTPGPNGEDGVEQTAIKVSLKC
  PITFRRIQLPARGHDCRHIQCFDLESYLQLNCERGTWRCPVCNKTALLEGLEVDQYMLGILIYIQNSDYEEITID
  PTCSWKPVPVKPDMHIKEEPDGPALKRCRTVSPAHVLMPSVMEMIAALGPGAAPFAPLQPPSVPAPSDYPGQGSS
  FLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQSDIPSSLLTSEKSTACLPSQMAPAGHLDPTHNPGTPGLHTS
  NLGAPPGPQLHHSNPPPASRQSLGQASLGPTGELAFSPATGVMGPPSMSGAGEAPEPALDLLPELTNPDELLSYL
  GPPDLPTNNNDDLLSLFENN

• Structural information:
  • Interpro: IPR004181  IPR013083  
  • Prosite: PS51044
  • STRING: ENSP00000311778
• Other Databases: GeneCards:  ZMIZ2  Malacards:  ZMIZ2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061665	SUMO ligase activity	IBA	molecular function
GO:0048096	chromatin-mediated maintenance of transcription	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IBA	molecular function
GO:0030374	nuclear receptor transcription coactivator activity	IBA	molecular function
GO:0016925	protein sumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0060395	SMAD protein signal transduction	IDA	NOT|biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	NOT|biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq