• Gene id: 836

Gene Summary

• Gene Symbol: CASP3   Gene   UCSC   Ensembl
• Aliases: CPP32, CPP32B, SCA-1
• Gene name: caspase 3
• Alternate names: caspase-3, CASP-3, CPP-32, PARP cleavage protease, SREBP cleavage activity 1, apopain, caspase 3, apoptosis-related cysteine peptidase, caspase 3, apoptosis-related cysteine protease, cysteine protease CPP32, procaspase3, protein Yama,
• Gene location: 4q35.1 (184649474: 184627695)     Exons: 9     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulat
• OMIM: 600636

SNPs

rs35033974

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.43416460G>T
NC_000019.9   g.43920612G>T
NM_031451.4   c.350G>T
XM_005259303.3   c.464G>T
XM_005259303.1   c.392G>T
NM_001130011.1   c.296G>T
NM_001130011.3   c.296G>T
NM_001130011.2   c.296G>T
NP_113639.4   p.Gly117Val
XP_005259360.2   p.Gly155Val
NP_00  

rs605059

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.42554888G>A
NC_000017.11   g.42554888G>C
NC_000017.11   g.42554888G>T
NC_000017.10   g.40706906G>A
NC_000017.10   g.40706906G>C
NC_000017.10   g.40706906G>T
NM_000413.3   c.937G>A
NM_000413.3   c.937G>C
NM_000413.3   c.937G>T
NM_000413.4   c.937G>A
NM_0  

Protein Summary

• Protein general information: P42574  
  • Name: Caspase 3 (CASP 3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP 32) (Protein Yama) (SREBP cleavage activity 1) (SCA 1) [Cleaved into: Caspase 3 subunit p17; Caspase 3 subunit p12]
  • Length: 277  
  • Mass: 31,608
• Sequence:

  MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLR
  ETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS
  LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQ
  YADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

• Structural information:
  • Interpro: IPR029030  IPR033139  IPR016129  IPR002138  IPR001309   IPR015917  
  • Prosite: PS01122 PS01121 PS50207 PS50208
  • CDD: cd00032
  • PDB: 1CP3 1GFW 1I3O 1NME 1NMQ 1NMS 1PAU 1QX3 1RE1 1RHJ 1RHK 1RHM 1RHQ 1RHR 1RHU 2C1E 2C2K 2C2M 2C2O 2CDR 2CJX 2CJY 2CNK 2CNL 2CNN 2CNO 2DKO 2H5I 2H5J 2H65 2J30 2J31 2J32 2J33 2XYG 2XYH 2XYP 2XZD 2XZT 2Y0B 3DEH 3DEI 3DEJ 3DEK 3EDQ 3GJQ 3GJR 3GJS 3GJT 3H0E 3ITN
  • PDBsum: 1CP3 1GFW 1I3O 1NME 1NMQ 1NMS 1PAU 1QX3 1RE1 1RHJ 1RHK 1RHM 1RHQ 1RHR 1RHU 2C1E 2C2K 2C2M 2C2O 2CDR 2CJX 2CJY 2CNK 2CNL 2CNN 2CNO 2DKO 2H5I 2H5J 2H65 2J30 2J31 2J32 2J33 2XYG 2XYH 2XYP 2XZD 2XZT 2Y0B 3DEH 3DEI 3DEJ 3DEK 3EDQ 3GJQ 3GJR 3GJS 3GJT 3H0E 3ITN
  • DIP: 268
  • STRING: ENSP00000311032
• Other Databases: GeneCards:  CASP3  Malacards:  CASP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0004190	aspartic-type endopeptidase activity	EXP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0005123	death receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	TAS	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	molecular function
GO:0009411	response to UV	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0010165	response to X-ray	IEA	biological process
GO:0016005	phospholipase A2 activator activity	IEA	molecular function
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0030216	keratinocyte differentiation	IBA	biological process
GO:0030218	erythrocyte differentiation	IDA	biological process
GO:0030218	erythrocyte differentiation	TAS	biological process
GO:0030220	platelet formation	TAS	biological process
GO:0030889	negative regulation of B cell proliferation	IEA	biological process
GO:0031264	death-inducing signaling complex	IEA	cellular component
GO:0032025	response to cobalt ion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0034349	glial cell apoptotic process	IEA	biological process
GO:0034612	response to tumor necrosis factor	TAS	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0035329	hippo signaling	TAS	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045165	cell fate commitment	IEA	biological process
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0046007	negative regulation of activated T cell proliferation	IEA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IMP	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IDA	molecular function
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	TAS	biological process
GO:0097194	execution phase of apoptosis	IMP	biological process
GO:0097194	execution phase of apoptosis	IDA	biological process
GO:0097200	cysteine-type endopeptidase activity involved in execution phase of apoptosis	IMP	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0004190	aspartic-type endopeptidase activity	EXP	molecular function
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0005123	death receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	TAS	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	molecular function
GO:0009411	response to UV	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0010038	response to metal ion	IEA	biological process
GO:0010165	response to X-ray	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0016005	phospholipase A2 activator activity	IEA	molecular function
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016485	protein processing	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0021766	hippocampus development	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0030216	keratinocyte differentiation	IEA	biological process
GO:0030216	keratinocyte differentiation	IBA	biological process
GO:0030218	erythrocyte differentiation	IDA	biological process
GO:0030218	erythrocyte differentiation	TAS	biological process
GO:0030220	platelet formation	TAS	biological process
GO:0030889	negative regulation of B cell proliferation	IEA	biological process
GO:0031264	death-inducing signaling complex	IEA	cellular component
GO:0032025	response to cobalt ion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0034349	glial cell apoptotic process	IEA	biological process
GO:0034612	response to tumor necrosis factor	TAS	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0035329	hippo signaling	TAS	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045165	cell fate commitment	IEA	biological process
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045786	negative regulation of cell cycle	IEA	biological process
GO:0046007	negative regulation of activated T cell proliferation	IEA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IEA	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IMP	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IDA	molecular function
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	TAS	biological process
GO:0097194	execution phase of apoptosis	IEA	biological process
GO:0097194	execution phase of apoptosis	IMP	biological process
GO:0097194	execution phase of apoptosis	IDA	biological process
GO:0097200	cysteine-type endopeptidase activity involved in execution phase of apoptosis	IEA	molecular function
GO:0097200	cysteine-type endopeptidase activity involved in execution phase of apoptosis	IMP	molecular function
GO:0004190	aspartic-type endopeptidase activity	EXP	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	TAS	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0008233	peptidase activity	IDA	molecular function
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	molecular function
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0030182	neuron differentiation	IBA	biological process
GO:0030216	keratinocyte differentiation	IBA	biological process
GO:0030218	erythrocyte differentiation	IDA	biological process
GO:0030218	erythrocyte differentiation	TAS	biological process
GO:0030220	platelet formation	TAS	biological process
GO:0034612	response to tumor necrosis factor	TAS	biological process
GO:0035329	hippo signaling	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IMP	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IDA	molecular function
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	TAS	biological process
GO:0097194	execution phase of apoptosis	IMP	biological process
GO:0097194	execution phase of apoptosis	IDA	biological process
GO:0097200	cysteine-type endopeptidase activity involved in execution phase of apoptosis	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa04115	p53 signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04657	IL-17 signaling pathway
hsa04726	Serotonergic synapse
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05203	Viral carcinogenesis
hsa05210	Colorectal cancer
hsa05222	Small cell lung cancer
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa05014	Amyotrophic lateral sclerosis
hsa05016	Huntington disease
hsa05416	Viral myocarditis
hsa04932	Non-alcoholic fatty liver disease
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05130	Pathogenic Escherichia coli infection
hsa05133	Pertussis
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa05146	Amoebiasis
hsa05145	Toxoplasmosis
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer	GAD: 17071630
Cancer (Adenocarcinoma)	GAD: 19052714
Cancer (bladder)	GAD: 19692168
Cancer (colorectal)	GAD: 19219602
Cancer (endometrial)	GAD: 19531679
Cancer (esophageal)	GAD: 20453000
Cancer (gastric)	GAD: 19269008
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 17071630
Cancer (myeloma)	GAD: 18381704
Cancer (Squamous cell)	GAD: 18829519
Clubfoot	GAD: 17534194
Mucocutaneous lymph node syndrome	GAD: 20423928
Hodgkin disease	GAD: 19573080
Multiple sclerosis	GAD: 19604093
Diabetes	GAD: 20299368
Bone diseases	GAD: 19453261
Autism	GAD: 19058789
Chronic renal failure	GAD: 21085059
Recurrent pregnancy loss (RPL)	INFBASE: 20969784
Recurrent pregnancy loss (RPL)	INFBASE: 23218678
Diminished ovarian reserve (DOR)	INFBASE: 16730720
Endometriosis	INFBASE: 24246915
Female infertility	INFBASE: 23218678
Male factor infertility	MIK: 12969693
Male factor infertility	MIK: 21812785
Male factor infertility	MIK: 12010237
Oligoasthenozoospermia	MIK: 25792659
Teratozoospermia	MIK: 15760967
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Obstructive azoospermia	MIK: 23359247
Varicocele	MIK: 19062002
Varicocele	MIK: 12010237
Male factor infertility	MIK: 26209830
Male factor infertility	MIK: 19062002
Sertoli cell only syndrome (SCOS)	MIK: 23359247
Oligozoospermia	MIK: 25792659
Oligozoospermia	MIK: 19597981
Asthenozoospermia	MIK: 25792659
Cryptozoospermia	MIK: 25792659
Hypospermatogenesis	MIK: 12010237
Asthenozoospermia	MIK: 15760967
Azoospermia	MIK: 21812785
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 18177647
Male infertility	MIK: 12969693
Varicocele	MIK: 12010237
Hypospermatogenesis	MIK: 12010237
Oligozoospermia	MIK: 19597981
Sertoli-cell-only syndrome	MIK: 23359247
Obstructive azoospermia	MIK: 23359247
Asthenozoospermia	MIK: 25792659
Oligoasthenozoospermia	MIK: 25792659
Male inferility	MIK: 25792659
Cryptozoospermia	MIK: 25792659
Semen quality defects	MIK: 26209830
Sperm motility defects	MIK: 26209830
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 19062002

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23359247	Oligozoospermia, obstructive azoospermia, Sertoli-cell-only syndrome			27 (5 Oligozoospermia, 9 obstructive azoospermia (4 congenital bilateral absence of the vas deferens; 5 secondary azoospermia), 13 non-obstructive azoospermia (5 hypospermatogenis; 3 maturation arrest; 5 Sertoli-cell-only syndrome))	Male infertility
26209830	Semen quality, Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase
26209830	Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR  p38 MAPK p53 PARP Caspase-3
25792659	Oligozoospermic, asthenozoospermic, oligoasthenozoospermic and cryptozoospermic, Male infertility				Male infertility
21812785	Azoospermia			18 (5 with oligozoospermia, 4 with congenital bilateral absence of the vas deferens (CBAVD), 5 with secondary obstructive azoospermia (sOAZ), 4 hypospermatogenesis)	Male infertility
19062002	Varicocele, Male infertility			24 (8 infertile varicocele patients, 16 fertile volunteers)	Male infertility	PARP-1 poly(ADP-ribose) X-ray repair cross-complementing 1 and apurinic/apyrimidinic endonuclease 1] caspase 9 active caspase 3 and cleaved PARP-1
18177647	Azoospermia			29 (25 diagnosed with azoospermia, 4 patients with normal testicular histology)	Male infertility	caspases (3 6 and 7) XIAP and Smac
15760967	Teratozoospermia, asthenozoospermia			67 (61 abnormal semen analysis, 6 normozoospermia)	Male infertility
12969693	Male factor infertility			43 (35 patients with idiopathic infertility, 8 normal healthy donors)	Male infertility	cytochrome c caspases 9 and caspase 3
12010237	Male infertility, varicocele, hypospermatogenesis			32 (26 infertile men with varicocele, 6 normal testicular specimens )	Male infertility	Bcl-2  Bax caspase-1 caspase-3
19597981	Oligozoospermia	SCA1 (CAG repeats)			Male infertility	SCA1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881