• Gene id: 83597

Gene Summary

• Gene Symbol: RTP3   Gene   UCSC   Ensembl
• Aliases: LTM1, TMEM7, Z3CXXC3
• Gene name: receptor transporter protein 3
• Alternate names: receptor-transporting protein 3, 3CxxC-type zinc finger protein 3, receptor (chemosensory) transporter protein 3, transmembrane protein 7, zinc finger, 3CxxC-type 3,
• Gene location: 3p21.31 (46497975: 46500949)     Exons: 2     NC_000003.12
• OMIM: 602408

Protein Summary

• Protein general information: Q9BQQ7  
  • Name: Receptor transporting protein 3 (3CxxC type zinc finger protein 3) (Transmembrane protein 7)
  • Length: 232  
  • Mass: 27031
  • Tissue specificity: Expressed predominantly in adult liver (PubMed
• Sequence:

  MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTFARFQCSSCSRNWASAQVLVLFHMNW
  SEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMIKDISLEGPHN
  SDNCEACLQGFCAGPIQVTSLPPSQTPRVHSIYKVEEVVKPWASGENVYSYACQNHICRNLSIFCCCVILIVIVV
  IVVKTAI

• Structural information:
  • Interpro: IPR026096  IPR026691  IPR027377  
  • STRING: ENSP00000296142
• Other Databases: GeneCards:  RTP3  Malacards:  RTP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006612	protein targeting to membrane	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0031849	olfactory receptor binding	IBA	molecular function
GO:0051205	protein insertion into membrane	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006612	protein targeting to membrane	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IDA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0031849	olfactory receptor binding	IBA	molecular function
GO:0051205	protein insertion into membrane	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881