• Gene id: 83593

Gene Summary

• Gene Symbol: RASSF5   Gene   UCSC   Ensembl
• Aliases: Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3
• Gene name: Ras association domain family member 5
• Alternate names: ras association domain-containing protein 5, Rap1-binding protein, Ras association (RalGDS/AF-6) domain family 5, Ras association (RalGDS/AF-6) domain family member 5, Ras effector-like protein, new ras effector 1, novel Ras effector 1, regulator for cell adhesi,
• Gene location: 1q32.1 (206507530: 206589447)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras,
• OMIM: 607020

Protein Summary

• Protein general information: Q8WWW0  
  • Name: Ras association domain containing protein 5 (New ras effector 1) (Regulator for cell adhesion and polarization enriched in lymphoid tissues) (RAPL)
  • Length: 418  
  • Mass: 47090
  • Tissue specificity: Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors. {ECO
• Sequence:

  MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGRSARRAARGNLEPPPR
  ASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERGEGHCFAELVLPGGPGWCDLCGREVLRQALR
  CTNCKFTCHPECRSLIQLDCSQQEGLSRDRPSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNC
  LGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
  VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIP
  ELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG

• Structural information:
  • Protein Domains: (274..36-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (366..41-)
    (/note="SARAH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00310"-)
  • Interpro: IPR033614  IPR002219  IPR000159  IPR033623  IPR011524   IPR029071  
  • Prosite: PS50200 PS50951 PS00479 PS50081
  • CDD: cd00029
  • PDB: 4LGD 4OH8
  • PDBsum: 4LGD 4OH8
  • DIP: 32490
  • STRING: ENSP00000462099
• Other Databases: GeneCards:  RASSF5  Malacards:  RASSF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0017016	Ras GTPase binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:1900180	regulation of protein localization to nucleus	IEA	biological process
GO:0031398	positive regulation of protein ubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04218	Cellular senescence
hsa04670	Leukocyte transendothelial migration
hsa05223	Non-small cell lung cancer

Diseases

Associated diseases	References
lung non-small cell carcinoma	PMID:20434789
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)