• Gene id: 83590

Gene Summary

• Gene Symbol: TMUB1   Gene   UCSC   Ensembl
• Aliases: C7orf21, DULP, HOPS, SB144
• Gene name: transmembrane and ubiquitin like domain containing 1
• Alternate names: transmembrane and ubiquitin-like domain-containing protein 1, dendritic cell-derived ubiquitin-like protein, hepatocyte odd protein shuttling protein, ubiquitin-like protein DULP, ubiquitin-like protein SB144,
• Gene location: 7q36.1 (151083492: 151081084)     Exons: 4     NC_000007.14
• OMIM: 600805

Protein Summary

• Protein general information: Q9BVT8  
  • Name: Transmembrane and ubiquitin like domain containing protein 1 (Dendritic cell derived ubiquitin like protein) (DULP) (Hepatocyte odd protein shuttling protein) (Ubiquitin like protein SB144) [Cleaved into: iHOPS]
  • Length: 246  
  • Mass: 26261
  • Tissue specificity: Ubiquitously expressed with highest levels in mammary and thyroid glands, bone marrow and spleen; limited expression in cardiac, pancreatic and ovarian tissues. {ECO
• Sequence:

  MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLR
  HRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLG
  DDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTA
  TLGLAGFTLLLSLLAFAMYRP

• Structural information:
  • Protein Domains: (103..17-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR040352  IPR000626  IPR029071  
  • Prosite: PS50053
  • STRING: ENSP00000376565
• Other Databases: GeneCards:  TMUB1  Malacards:  TMUB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IMP	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881