• Gene id: 83548

Gene Summary

• Gene Symbol: COG3   Gene   UCSC   Ensembl
• Aliases: SEC34
• Gene name: component of oligomeric golgi complex 3
• Alternate names: conserved oligomeric Golgi complex subunit 3, COG complex subunit 3, p94, tethering factor SEC34, vesicle-docking protein SEC34 homolog,
• Gene location: 13q14.13 (45464915: 45536700)     Exons: 24     NC_000013.11
• Gene summary(Entrez): This gene encodes a component of the conserved oligomeric Golgi (COG) complex which is composed of eight different subunits and is required for normal Golgi morphology and localization. Defects in the COG complex result in multiple deficiencies in protein
• OMIM: 192340

Protein Summary

• Protein general information: Q96JB2  
  • Name: Conserved oligomeric Golgi complex subunit 3 (COG complex subunit 3) (Component of oligomeric Golgi complex 3) (Vesicle docking protein SEC34 homolog) (p94)
  • Length: 828  
  • Mass: 94096
  • Tissue specificity: Widely expressed with highest levels in pancreas and testis and lowest levels in lung. {ECO
• Sequence:

  MAEAALLLLPEAAAERDAREKLALWDRRPDTTAPLTDRQTDSVLELKAAAENLPVPAELPIEDLCSLTSQSLPIE
  LTSVVPESTEDILLKGFTSLGMEEERIETAQQFFSWFAKLQTQMDQDEGTKYRQMRDYLSGFQEQCDAILNDVNS
  ALQHLESLQKQYLFVSNKTGTLHEACEQLLKEQSELVDLAENIQQKLSYFNELETINTKLNSPTLSVNSDGFIPM
  LAKLDDCITYISSHPNFKDYPIYLLKFKQCLSKALHLMKTYTVNTLQTLTSQLLKRDPSSVPNADNAFTLFYVKF
  RAAAPKVRTLIEQIELRSEKIPEYQQLLNDIHQCYLDQRELLLGPSIACTVAELTSQNNRDHCALVRSGCAFMVH
  VCQDEHQLYNEFFTKPTSKLDELLEKLCVSLYDVFRPLIIHVIHLETLSELCGILKNEVLEDHVQNNAEQLGAFA
  AGVKQMLEDVQERLVYRTHIYIQTDITGYKPAPGDLAYPDKLVMMEQIAQSLKDEQKKVPSEASFSDVHLEEGES
  NSLTKSGSTESLNPRPQTTISPADLHGMWYPTVRRTLVCLSKLYRCIDRAVFQGLSQEALSACIQSLLGASESIS
  KNKTQIDGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGT
  PEIREHYLDSKKDVDRHLKSACEQFIQQQTKLFVEQLEEFMTKVSALKTMASQGGPKYTLSQQPWAQPAKVNDLA
  ATAYKTIKTKLPVTLRSMSLYLSNKDTEFILFKPVRNNIQQVFQKFHALLKEEFSPEDIQIIACPSMEQLSLLLL
  VSK

• Structural information:
  • Interpro: IPR007265  
  • STRING: ENSP00000258654
• Other Databases: GeneCards:  COG3  Malacards:  COG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0017119	Golgi transport complex	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0017119	Golgi transport complex	IDA	cellular component
GO:0017119	Golgi transport complex	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006891	intra-Golgi vesicle-mediated transport	IDA	biological process
GO:0007030	Golgi organization	IGI	biological process
GO:0033365	protein localization to organelle	IMP	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0006486	protein glycosylation	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq