• Gene id: 83540

Gene Summary

• Gene Symbol: NUF2   Gene   UCSC   Ensembl
• Aliases: CDCA1, CT106, NUF2R
• Gene name: NUF2 component of NDC80 kinetochore complex
• Alternate names: kinetochore protein Nuf2, NDC80 kinetochore complex component NUF2, NUF2, NDC80 kinetochore complex component, homolog, cancer/testis antigen 106, cell division cycle associated 1, cell division cycle-associated protein 1, hNuf2, hNuf2R, hsNuf2,
• Gene location: 1q23.3 (163321947: 163355763)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the sp
• OMIM: 187410

Protein Summary

• Protein general information: Q9BZD4  
  • Name: Kinetochore protein Nuf2 (hNuf2) (hNuf2R) (hsNuf2) (Cell division cycle associated protein 1)
  • Length: 464  
  • Mass: 54304
• Sequence:

  METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMY
  PHLMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSAD
  KMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQKTIVLQEGNSQKKSNISEKTKRLNE
  LKLSVVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKI
  QDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKEKLATAQFKINKKHEDVKQYKRTVIE
  DCNKVQEKRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQEIFLNLKTALEKYHDGIEKAAEDSYAKIDE
  KTAELKRKMFKMST

• Structural information:
  • Interpro: IPR005549  IPR038275  
  • PDB: 2VE7 3IZ0
  • PDBsum: 2VE7 3IZ0
  • DIP: 36119
  • STRING: ENSP00000271452
• Other Databases: GeneCards:  NUF2  Malacards:  NUF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051383	kinetochore organization	IBA	biological process
GO:0045132	meiotic chromosome segregation	IBA	biological process
GO:0007052	mitotic spindle organization	IBA	biological process
GO:0051315	attachment of mitotic spindle microtubules to kinetochore	IBA	biological process
GO:0044877	protein-containing complex binding	IBA	molecular function
GO:0031262	Ndc80 complex	IBA	cellular component
GO:0000778	condensed nuclear chromosome kinetochore	IBA	cellular component
GO:0031262	Ndc80 complex	IDA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0031262	Ndc80 complex	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0000775	chromosome, centromeric region	NAS	cellular component
GO:0007059	chromosome segregation	NAS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R