• Gene id: 83539

Gene Summary

• Gene Symbol: CHST9   Gene   UCSC   Ensembl
• Aliases: GALNAC4ST-2, GalNAc4ST2
• Gene name: carbohydrate sulfotransferase 9
• Alternate names: carbohydrate sulfotransferase 9, GalNAc-4-sulfotransferase 2, N-acetylgalactosamine 4-O-sulfotransferase 2, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 9, galNAc-4-O-sulfotransferase 2,
• Gene location: 18q11.2 (27185363: 26906480)     Exons: 16     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans.
• OMIM: 610191

Protein Summary

• Protein general information: Q7L1S5  
  • Name: Carbohydrate sulfotransferase 9 (EC 2.8.2. ) (GalNAc 4 O sulfotransferase 2) (GalNAc 4 ST2) (GalNAc4ST 2) (N acetylgalactosamine 4 O sulfotransferase 2)
  • Length: 443  
  • Mass: 52055
  • Tissue specificity: Highly expressed in trachea. Also expressed in fetal lung, adult pancreas, testis and salivary gland. Expressed at low level in pituitary gland, apex of the heart, adult lung, prostate and mammary gland. Weakly or not expressed in hear
• Sequence:

  MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQE
  HITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFNKFSNMN
  WPVDIHPLNKSLVKDNKWKKTEETQEKRRSFLQEFCKKYGGVSHHQSHLFHTVSRIYVEDKHKILYCEVPKAGCS
  NWKRILMVLNGLASSAYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSY
  YHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHWEKVSKLCYPCLINYDFVGKFETLEE
  DANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRTERQLIYDFYYLDYLMFNYTTPFL

• Structural information:
  • Interpro: IPR018011  IPR005331  
  • STRING: ENSP00000480991
• Other Databases: GeneCards:  CHST9  Malacards:  CHST9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0030166	proteoglycan biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016051	carbohydrate biosynthetic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	IDA	molecular function
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0030203	glycosaminoglycan metabolic process	NAS	biological process
GO:0030166	proteoglycan biosynthetic process	ISS	biological process
GO:0042446	hormone biosynthetic process	ISS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0001537	N-acetylgalactosamine 4-O-sulfotransferase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq