About Us

Search Result


Gene id 8349
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol H2BC21   Gene   UCSC   Ensembl
Aliases GL105, H2B, H2B.1, H2BE, H2BFQ, H2BGL105, H2BQ, HIST2H2BE
Gene name H2B clustered histone 21
Alternate names histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2 H2B family member e, histone cluster 2, H2be,
Gene location 1q21.2 (149886681: 149884458)     Exons: 1     NC_000001.11
Gene summary(Entrez) Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA
OMIM 601831

Protein Summary

Protein general information Q16778  

Name: Histone H2B type 2 E (H2B clustered histone 21) (Histone H2B GL105) (Histone H2B.q) (H2B/q)

Length: 126  Mass: 13920

Sequence MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIA
GEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Structural information
Interpro:  IPR009072  IPR007125  IPR000558  
Prosite:   PS00357

PDB:  
4NFT 6A7U
PDBsum:   4NFT 6A7U

DIP:  

39324

MINT:  
STRING:   ENSP00000358151
Other Databases GeneCards:  H2BC21  Malacards:  H2BC21

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003677 DNA binding
IBA molecular function
GO:0006334 nucleosome assembly
IBA biological process
GO:0000786 nucleosome
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0046982 protein heterodimerizatio
n activity
IEA molecular function
GO:0000786 nucleosome
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0042742 defense response to bacte
rium
IEA biological process
GO:0003677 DNA binding
IEA molecular function
GO:0005694 chromosome
IEA cellular component
GO:0005654 nucleoplasm
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005694 chromosome
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0050830 defense response to Gram-
positive bacterium
IDA biological process
GO:0019731 antibacterial humoral res
ponse
IDA biological process
GO:0002227 innate immune response in
mucosa
IDA biological process
GO:0061844 antimicrobial humoral imm
une response mediated by
antimicrobial peptide
IDA biological process
GO:0005634 nucleus
IDA cellular component
GO:0000786 nucleosome
NAS cellular component
GO:0005634 nucleus
HDA cellular component
GO:0006334 nucleosome assembly
NAS biological process
GO:0070062 extracellular exosome
HDA cellular component
GO:0003677 DNA binding
NAS molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05034Alcoholism
hsa05203Viral carcinogenesis
hsa05322Systemic lupus erythematosus
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract