• Gene id: 83461

Gene Summary

• Gene Symbol: CDCA3   Gene   UCSC   Ensembl
• Aliases: GRCC8, TOME-1
• Gene name: cell division cycle associated 3
• Alternate names: cell division cycle-associated protein 3, gene-rich cluster protein C8, trigger of mitotic entry protein 1,
• Gene location: 12p13.31 (40647677: 40626920)     Exons: 7     NC_000023.11
• OMIM: 607749

Protein Summary

• Protein general information: Q99618  
  • Name: Cell division cycle associated protein 3 (Gene rich cluster protein C8) (Trigger of mitotic entry protein 1) (TOME 1)
  • Length: 268  
  • Mass: 28998
• Sequence:

  MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPTLGIAR
  TPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWNQTEFPSKQVF
  SKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLS
  ENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES

• Structural information:
  • Interpro: IPR038832  
  • STRING: ENSP00000442068
• Other Databases: GeneCards:  CDCA3  Malacards:  CDCA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005912	adherens junction	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray